(data stored in SCRATCH zone)

EMBL: CP001778.PE23

CP001778.PE23        Location/Qualifiers
FT   CDS_pept        complement(29910..30440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39746"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY8"
FT                   /inference="similar to AA sequence:KEGG:Sde_2508"
FT                   /protein_id="ADD39746.1"
FT                   /translation="MPTKKLPSPVYAAAGAGEALVEQLKKLPSKAEELRDRTKLDERAT
FT                   KLRETVTENVKQGVDTLKHLDREKLREVALETASTLGEKAREAREKAAETYSEFVERGE
FT                   HVVAGERGPIKVISTVAKEDAKADTEAKVEQAKAEATEKAEAKPATRKPAAKKSTAKKT
FT                   TTKKATTKAEGAK"
     atgccgacca agaaacttcc ctcgcccgtg tacgccgccg ccggcgccgg agaggccctg        60
     gtggagcagc tgaagaaact gccgtccaag gccgaggaac tgcgcgaccg caccaagctg       120
     gacgagcgcg ccaccaagct gcgcgagacc gtcaccgaga acgtcaagca gggcgtcgac       180
     acgctgaagc acctggaccg ggagaagctg cgcgaggtcg cgctggagac cgcctccaca       240
     ctgggtgaga aggcccgcga ggcccgcgag aaggccgccg aaacctactc ggagttcgtc       300
     gagcgcggcg agcacgtcgt cgccggtgag cgcggcccga tcaaggtgat ctcgaccgtg       360
     gccaaggagg acgccaaggc cgacaccgag gccaaggtcg agcaggccaa ggccgaggcg       420
     accgagaagg ccgaggcgaa gcccgccact cgcaagcccg ccgccaagaa gtcgacggcg       480
     aagaagacca ccaccaagaa ggccaccacc aaggccgagg gcgccaagta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page