(data stored in SCRATCH zone)

EMBL: CP001778.PE230

CP001778.PE230       Location/Qualifiers
FT   CDS_pept        249371..250384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_6226 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39953"
FT                   /db_xref="GOA:D3Q2Y3"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39953.1"
FT                   /translation="MRRNNGSLPPAISLFFLTPVIAEFLPGYLSLDSLVTALVLAPMYG
FT                   GGALLIRELTRRAGRGWWTILILGLAYGVVEEGFGTQSLFNPHYADLELLQPAHLPGLG
FT                   MGAWWTVFVVALHAVWSIALPIAIVEAFTASRPRQPWLGRIGLTVTALVFALGVAVIAS
FT                   FTMAGDDFRATPGQFIGAAVAVVLLATLALTLGGKLDAQTLAERAAPPVWLVTALSLLA
FT                   GAAFAGSAFLVSSGGADQLGWPLVLGYLVLVALMVTIVRHWSVSPDWGDAHRLALAGGA
FT                   LLTYAANAFIETPSTPVDPALDLAGNLGFALGAVVLLLLATRRVSNTALRPQRVGQ"
     atgagacgca ataatggatc gttgcccccg gcgataagcc tcttcttcct cacccccgtc        60
     atcgcggaat tcctgcccgg ctacctgtcg ctcgacagcc tcgtcaccgc cctcgtgctc       120
     gccccgatgt acggcggcgg cgcactgctg atccgcgagc tcacccggcg cgcgggacgc       180
     ggctggtgga cgatcctgat cctcggcctc gcctacggcg tcgtcgagga gggattcggc       240
     acccagtcgc tgttcaaccc gcactacgcc gatctggaac tgctgcaacc ggcgcacctg       300
     cccggcctcg gcatgggcgc ctggtggacg gtgttcgtcg tcgcgctgca cgcggtgtgg       360
     agcatcgccc ttcccatcgc catcgtggag gcgttcaccg cttcgcgccc aaggcaaccg       420
     tggctcggcc ggatcgggct caccgtcacc gcgctggtct tcgcgctcgg cgtcgccgtg       480
     atcgcgtcct tcaccatggc cggggacgac ttccgcgcca cacccggaca gttcatcggc       540
     gccgccgtcg cggtagtcct actagcgacc ctggccctga cactcggcgg aaagctggac       600
     gcccaaaccc tcgccgagcg cgccgcacca cccgtgtggt tggtcacggc gctgtcgctg       660
     ctggccggtg cggcgttcgc cggatccgcg ttcctggtct cctcgggagg ggccgaccaa       720
     ctcggctggc cactggtcct cggctacctg gtcctggtcg cgctgatggt caccatcgtg       780
     cggcactggt ccgtcagccc cgactggggc gacgcccacc ggctcgcact cgccggaggc       840
     gcactgctca cctacgccgc caacgcgttc atcgaaaccc cgtccacgcc cgtcgatccg       900
     gccctcgacc tggcgggcaa cctcggcttc gccctcggcg ccgtcgtcct gctgctcctg       960
     gccacgcgcc gggtgtcgaa caccgcgctt cgcccacagc gtgtcggcca atag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page