(data stored in SCRATCH zone)

EMBL: CP001778.PE25

CP001778.PE25        Location/Qualifiers
FT   CDS_pept        complement(31080..33551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0026"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: sfu:Sfum_2279 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39748"
FT                   /db_xref="GOA:D3PTZ0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ0"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADD39748.1"
FT                   /translation="MNEDALNTGSAAEPTAFPPVPPPASPADSPPRWRGLALAYVIIAG
FT                   VAVVGIALVALTGGWVADQLKLYMDETISRGSWPMLTLITAVVAALFCAPLPFLRRLPR
FT                   VAAVGWAWLGGCAAMAVLGATRVVPVAAGEWQLLVQAVAFSIVAGALWLVARWGDRRES
FT                   PADDHNHAGDNEADVAPPAPGAFWLALSLGGLTILPWAWFGALGGLWETLLAAAVALAF
FT                   AAVAAFVVGDRYWSTFAPSPTDAETGSSRTGVSAAARIWGGGSAAGVALLLLSSGVGAA
FT                   GLQIPIMITLAAMGFAIAAVMSRPRRCGRVVAAAVAPAVFGPLAFADGDEFVLALLNPE
FT                   IGQWAGIALATAVVTAWIVGLVYGVAQRRIVAYPSAAAALAVVVAAACVAANGVSQPGL
FT                   HGEKLFVVMEKQADLSGVDGDREQRLTEVHKRLIDTAKSSQKSLRAELDDRGLEYQSFY
FT                   LVNAIEVDTDQFSRSWLESRDDVAKVLLSPQLRPLRTPAGPDTGTKLDSTDPQPNIEKV
FT                   GAPKVWDKADGEGITIGISDSGVDGDHPAFADRFRGGDDSWADPVNDTAKPNDPNGHGT
FT                   HALGLALGGNGVGVAPGAEWIGCTNLPRNAANPADYLSCLQFMLAPYPHGGDPVADGDP
FT                   TRAPHVLNNSWGCPGIEGCDATVLGGAVRAFDAAGVFFVVSAGNSGPTCGSAKTPPANY
FT                   RYAYSVGAVNSDDELASFSSRGPVTADGRKVAKPEISAPGVDVISAMPGGGYGPNTGTS
FT                   MAGPHVAGAVALLWSANPELVGDIENTKDILNRTAAEVTKAEAGSSLDDCGENAAGAGI
FT                   VDVAKAVSEKS"
     gtgaatgagg atgctctcaa caccggatcc gcggccgaac cgacggcctt cccgccggtc        60
     ccacctccgg cctcacctgc ggattccccg ccgcgatggc gcggactggc cctggcctat       120
     gtgatcatcg ccggtgtcgc cgtcgtgggg atcgcgctgg tcgccctgac cgggggctgg       180
     gtcgccgatc agttgaagct gtacatggac gagacgatct cgcggggcag ctggccgatg       240
     ttgacgctga tcacggcggt ggtggccgcg ctgttctgcg cgccgttgcc gttcctgcgc       300
     cgtctgcccc gggtcgcggc ggtgggctgg gcgtggctgg gcggctgcgc cgccatggcc       360
     gtcctcggcg ccacccgcgt ggtgccggtg gccgcggggg agtggcagct gctggtgcag       420
     gcggtggcgt tctccatcgt ggccggtgct ttgtggctgg tcgcccggtg gggtgaccgg       480
     cgggagagcc cggccgacga ccacaaccac gccggagaca acgaggccga cgtcgcgccg       540
     cccgctccgg gtgcgttctg gctggcgttg agcctcggcg gactgaccat cctgccgtgg       600
     gcctggttcg gggcgttggg cggattgtgg gagacgctgc tggcggcggc cgtcgcgttg       660
     gccttcgcgg ccgtggcggc tttcgttgtg ggcgaccggt actggtcgac gttcgcgccc       720
     tcccccaccg acgccgagac cgggtcgagc cgcaccgggg tctctgccgc ggcgcggatc       780
     tggggcggcg gctcggcggc cggggtcgcg ttgctgctgc tgagcagtgg tgtcggcgcg       840
     gccggtcttc agattccgat catgatcacc ctggccgcca tgggtttcgc catcgcggcg       900
     gtcatgtcgc gcccgcgtcg ctgcggccgg gtggtcgccg ccgcggtcgc cccggcggtg       960
     ttcggcccgc tggccttcgc cgacggcgac gagttcgtcc tggcgttgct caaccccgag      1020
     atcgggcagt gggccgggat cgcgctggcc accgccgtcg tcaccgcctg gatcgtcggg      1080
     ctggtctacg gggtggcgca acgccggatc gtggcctacc cgtcggcggc cgccgcactg      1140
     gccgtcgtgg tcgcggcggc atgcgtggcc gccaacgggg tgtcgcagcc gggtctgcac      1200
     ggcgagaagc tgttcgtcgt catggagaag caggccgatc tgtccggtgt cgacggtgac      1260
     cgcgagcagc ggctcaccga ggtccacaag cgcctgatcg acaccgccaa gtcgtcccag      1320
     aagtcgctgc gcgccgaact ggacgaccgg gggctggaat accagtcctt ctatctggtc      1380
     aacgcgatcg aggtcgacac cgaccagttc tcccggtcct ggctggagtc ccgcgacgac      1440
     gtcgccaagg tgctattgag cccgcagctg cggccgctgc gcaccccggc cgggcccgac      1500
     accgggacga aactcgactc gaccgacccg cagcccaaca tcgagaaggt cggcgcgccg      1560
     aaggtctggg acaaggccga cggcgagggc atcaccatcg gcatctccga ttccggcgtg      1620
     gacggcgatc acccggcctt cgccgaccgg ttccgcggcg gcgacgactc ctgggccgac      1680
     ccggtcaacg acaccgcgaa acccaacgac cccaacggac acggcaccca tgcgctgggc      1740
     ctggccctgg gcggcaacgg ggtcggcgtc gcgccgggcg ccgagtggat cgggtgcacg      1800
     aacctgcccc gcaacgccgc caatcccgcc gactacctgt cctgcctgca gttcatgctc      1860
     gccccctacc cgcacggcgg cgatccggtc gccgacgggg atccaacgcg ggcaccgcac      1920
     gtgctcaaca actcctgggg ctgcccgggc atcgagggct gtgacgcgac ggtgctgggc      1980
     ggcgcggtgc gggccttcga cgcggccggg gttttcttcg tcgtttcggc gggtaacagt      2040
     ggtccgacgt gcggttcagc caagacaccg cccgccaact accggtacgc ctacagcgtc      2100
     ggggccgtca actccgacga cgaactcgcc tccttctcca gcaggggacc ggtcacagcg      2160
     gatgggagga aggtcgccaa accggagatc tcggctcccg gagtggacgt catctcggcg      2220
     atgccgggcg gtggctacgg tcccaatacc ggcacctcca tggccggacc gcacgtcgcc      2280
     ggggcggtgg ccctgctgtg gtcggcgaac ccggagctgg tcggcgacat cgaaaacaca      2340
     aaggacattc tcaatcggac ggccgccgag gtcaccaagg ccgaagccgg ttcctcattg      2400
     gatgactgcg gcgagaacgc ggccggagcc gggatcgtcg acgtcgcgaa ggccgtttct      2460
     gagaagagct ga                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page