(data stored in SCRATCH zone)

EMBL: CP001778.PE251

CP001778.PE251       Location/Qualifiers
FT   CDS_pept        268924..269415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39974"
FT                   /db_xref="GOA:D3Q304"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q304"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39974.1"
FT                   /translation="MATTPRHWTLPRILVRVVLFFSLFGPALADLAIPDVAAMHLHNPN
FT                   WPPHAKFHDAQYLVMAALLAAIGLTMLWRRTGNLRLQFHWAAALASVTWLAMFAALLFP
FT                   GTGIIDPEFVADNVSILGLNPQLFIALVMLVLLAVAVGVERFGRRIPLAPESNRTPAAA
FT                   "
     atggccacca ccccacgaca ctggacgctg ccacgaatcc tggtgcgcgt cgtgctgttc        60
     ttctcgctgt tcggcccggc gctggccgac ctcgccatcc ccgacgtcgc cgcgatgcac       120
     ctgcacaacc cgaactggcc accgcacgcc aagttccacg acgcgcagta cctcgtgatg       180
     gccgcgctgt tggccgccat tggtctcacc atgttgtggc gccgcaccgg gaacctccgg       240
     ctccagttcc actgggcggc ggcgctcgcg tcggtgacct ggctggccat gttcgccgcg       300
     ctgctgttcc ccgggaccgg catcatcgac cccgagttcg tcgccgacaa cgtgtccatc       360
     ctcgggctga acccgcagct gttcatcgcg ctggtcatgc tcgtgctgtt ggccgtcgcc       420
     gtcggtgtcg aacggttcgg gcgacgcatt ccgctggccc ccgagtcgaa ccgcaccccc       480
     gcggcggcct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page