(data stored in SCRATCH zone)

EMBL: CP001778.PE259

CP001778.PE259       Location/Qualifiers
FT   CDS_pept        complement(278327..278713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q312"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39982.1"
FT                   /translation="MAKEVQADFVELGVLGKAFTTAGTGLRTGLKDMREEGLIPANAFG
FT                   NTPGAEGFNESYSDVLEKAGQAMEDLADTVERDSDNVYRVAFAYQKTDLDNKAKIDANT
FT                   EKEKLDRLREEVGSVPYPSKPTIV"
     atggcaaagg aagtacaggc cgatttcgtt gagctgggtg tcctcggcaa ggcattcacc        60
     accgccggta ccggcctgcg caccggcctg aaggacatgc gcgaggaggg gctcatcccc       120
     gccaacgcgt tcggcaacac ccccggcgcc gagggcttca acgagtccta ttcggacgtc       180
     ctcgagaagg cgggacaggc gatggaggac ctcgccgaca ccgtcgagcg cgactccgac       240
     aacgtctacc gggtcgcctt cgcctaccag aagaccgatc tggacaacaa ggccaagatc       300
     gacgccaaca ccgagaagga gaagctggac cggctccgcg aagaggtcgg cagcgtcccc       360
     tatcccagca agccaacgat cgtttag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page