(data stored in SCRATCH zone)

EMBL: CP001778.PE26

CP001778.PE26        Location/Qualifiers
FT   CDS_pept        33595..35343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0027"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39749"
FT                   /db_xref="GOA:D3PTZ1"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADD39749.1"
FT                   /translation="MRADRTQSRYQAGALSPQRRAADLERMRTEHFDVLIIGGGVTGTG
FT                   AALDAASRGLKVALVEARDYSSGTSSRSSKLIHGGLRYLEQFEFGLVHEALTERGLLCH
FT                   RIAPHLVHPLAFLAPLSGRVWQRAYYGAGLALYDTLATALGGSSGRLPLHRHLSKRRTR
FT                   RLFPGLSSQKVLGSIKYFDAQTDDARFVTTMARTAASYGAAMATSARVVGFQRDARQVT
FT                   GARVADMETGDEFDVSATTIIAATGVWSNDLSGMLGSQVGLRVRASKGIHLVVKRSAIN
FT                   GDSAIILRTSSSVLFILPWGGHWVIGTTDTDWSLDRDHPAASAIDVAYLLELANGILER
FT                   PLSIDDVEGVYAGLRPLLSGEDEDTSSLSREHAVVEPMLGLLLVAGGKFTTYRIMAKDA
FT                   VDRAARRLHGVPASRTADIPLLGADGYRQAWAGRERLASRTGVHPGIVEHLLRRYGTLA
FT                   QEVLALIAENPKFGEPLAGAPEYLAAEVVYAVRNEGALHTDDVLTRRTRVSIETSHRGE
FT                   KSVEHVVALMGDELGWDKATRDNEISHYLSRVAAERDSQRQPDDATADAARLGAEDVRV
FT                   GLNTPV"
     atgcgagccg atcgaaccca gtcccggtat caggccggag ccctttcgcc gcagcgtcgc        60
     gccgccgacc tggagcgtat gcgcaccgag cacttcgacg tgctgatcat cggcgggggc       120
     gtcaccggaa ccggagccgc gctggacgcc gccagccggg gcctgaaagt ggcccttgtg       180
     gaggcccgcg actactcctc gggcacctcc agccggtcga gcaagctcat ccacggcgga       240
     ctgcgctacc tggagcagtt cgagttcgga ctcgtccacg aggcccttac cgaacgcggg       300
     ctgctgtgcc accggatcgc gccacacctg gtgcacccct tggcattcct ggccccactg       360
     tcgggccggg tctggcagcg cgcctactac ggcgccgggc tggcgctgta cgacaccctg       420
     gccacggcgc tgggcggcag cagcggcagg ctcccgctgc accggcacct gtccaagcgc       480
     cgcacccggc gactgttccc gggcctgtcc agccagaagg tgctcggctc catcaagtac       540
     ttcgacgccc agaccgacga cgcccgcttc gtcaccacga tggcccgcac cgccgcgtcc       600
     tacggcgccg cgatggcgac ctcggcgcgg gtggtcggct tccagcgcga cgcccgccag       660
     gtcaccggcg cccgggtggc cgacatggag accggcgacg agttcgacgt ctcggccacc       720
     acgatcatcg cggccaccgg cgtgtggagc aacgacctgt ccggcatgct cggcagccag       780
     gtgggactgc gggtccgcgc cagcaagggc atccacctgg tcgtcaaacg cagcgccatc       840
     aacggcgact cggcgatcat cctgcgcacc tcgtccagcg tcctgttcat cctgccgtgg       900
     ggcggccatt gggtcatcgg caccaccgac accgactggt cactggaccg cgaccacccg       960
     gcggcctcgg ccatcgacgt ggcctacctc ctggaactgg ccaacggcat cctggaacgt      1020
     ccactgtcca tagacgacgt cgagggcgtc tacgcggggc tgcggccgct gctgtccgga      1080
     gaggacgagg acacctcctc gctgtcgcgc gagcacgccg tcgtcgaacc catgctcggc      1140
     ctgctgctgg tggcgggcgg caagttcacc acctaccgga tcatggccaa ggacgcggtc      1200
     gaccgggcgg cccgccgcct gcacggcgtc cccgcctccc gcaccgccga catcccgctc      1260
     ttgggagccg acggctaccg acaggcctgg gccggtcgcg aacgcctcgc ctcccgcacc      1320
     ggggtgcacc cgggcatcgt cgaacacctg ctgcgccgct acggaaccct ggcccaggag      1380
     gtactggcgc tgatcgccga gaaccccaag ttcggcgaac cactggcggg cgcgcccgaa      1440
     tacctggccg ccgaggtcgt ctacgcggtc cgcaacgagg gcgccctgca caccgacgac      1500
     gtcctgaccc gccgcacccg ggtctccatc gagaccagcc accggggcga gaagtcggtg      1560
     gaacacgtcg tggcgctgat gggcgacgaa ctcggctggg acaaggccac ccgcgacaac      1620
     gagatctccc actacctgtc ccgggtcgcg gccgaacgcg actcgcagcg gcaacccgac      1680
     gacgccaccg ccgacgcggc ccgactggga gccgaggacg tccgggtcgg cctgaacacc      1740
     ccggtgtag                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page