(data stored in SCRATCH zone)

EMBL: CP001778.PE263

CP001778.PE263       Location/Qualifiers
FT   CDS_pept        complement(283551..284444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfm:Xfasm12_0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39986"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q316"
FT                   /inference="similar to AA sequence:KEGG:Xfasm12_0778"
FT                   /protein_id="ADD39986.1"
FT                   /translation="MRKRHLIYATLLATVGLSVAGVAGFASADPASEAERQSAKASKLD
FT                   TTTDLDEYWTPERIANAKPVTAPKASRASGDSQPDGESVVIDGTKPKLKSPVDTTIGRL
FT                   LFTTDDGDYICSANVVPSDNGSVLATARHCGFENNGRNYRFAPDYDSGNTPHGWWDWKS
FT                   AGWTSGGDGVAFDYAFIVLNKKDGRTVQDTVGSSGIAFNNAIDRDAQITGIPGATDAVF
FT                   HCNGKAYTNGNNQQLMDNCDGMSGGASGGAWLQDMDGGSGYQVGTYFGSVGSAAAGSYF
FT                   GEEAREVWTGASTTPV"
     atgcgcaaac ggcatctcat ctatgccact ttgcttgcca cggttggttt gtccgtggcg        60
     ggagtggcgg gtttcgcctc ggctgacccg gcatccgagg cggaacgaca gtcagcgaaa       120
     gcctcgaaac tagacacgac aacggatctg gacgagtact ggacgccgga acggatcgcg       180
     aacgcgaagc cggtgaccgc gccgaaggcc agcagggcga gtggcgacag ccagcccgac       240
     ggcgagtccg tcgtcatcga cgggacgaaa ccgaagctca agtcgcctgt ggacaccacg       300
     atcgggcggc tgctgttcac caccgacgac ggcgactaca tctgttcggc caacgtggtt       360
     cccagtgaca acgggtccgt cctcgccacc gcgcgccact gtggattcga gaacaacggc       420
     cgcaactacc gcttcgcgcc cgactacgac tcgggcaaca ccccgcacgg ctggtgggac       480
     tggaagtcgg ccgggtggac cagcggcggc gacggggtcg cgttcgacta cgcgttcatc       540
     gtcctcaaca agaaggacgg ccggacggtg caggacaccg tcggttccag cgggatcgcg       600
     ttcaacaacg cgatcgaccg cgacgcccag atcaccggca tccccggcgc caccgacgcg       660
     gtgttccact gcaacggcaa ggcgtacacc aacggcaaca accagcagct catggacaac       720
     tgcgacggca tgtcgggcgg tgccagcggc ggcgcctggt tgcaggacat ggacggtggc       780
     agcggatacc aggtcgggac gtacttcggc agcgtcggtt cggccgccgc cgggagttac       840
     ttcggcgagg aggcgcggga ggtgtggacc ggcgccagca ccacaccggt gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page