(data stored in SCRATCH zone)

EMBL: CP001778.PE266

CP001778.PE266       Location/Qualifiers
FT   CDS_pept        complement(286165..286587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0271"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bid:Bind_1015 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39989"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q319"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADD39989.1"
FT                   /translation="MSDKTTRPVPIDVDPELACPIAPVVDIVFSRWTTPILWALNEFGR
FT                   QRFVELERAITTITPKVLTQRLRQLERDGLVSRAYYPEVPPRVEYEITELGRSLAPLFA
FT                   SLAEWSVNLDKVEQARRDYDERVHGSRRGTPPSTQR"
     gtgagcgaca agacaacccg tccggtgccc atcgacgtcg acccggaact ggcctgcccg        60
     atcgcccccg tcgtcgacat cgtcttcagt cgctggacca ccccgatcct gtgggccctc       120
     aacgaattcg ggcgacagcg cttcgtcgaa ctggagcgcg ccatcaccac gatcacgccc       180
     aaggtgctga cccagcggct gcggcaactg gaacgcgacg gcctggtctc gcgcgcctac       240
     tacccggagg tcccgccccg ggtggagtac gagatcaccg aactggggcg gagtctggcg       300
     ccgctgttcg cgtcgctcgc cgaatggtcg gtcaacctgg acaaggtcga gcaggcccgg       360
     cgggactacg acgagcgggt tcacgggtcg cggcgcggaa cgccgccgtc tactcagcgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page