(data stored in SCRATCH zone)

EMBL: CP001778.PE275

CP001778.PE275       Location/Qualifiers
FT   CDS_pept        complement(292962..294164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0280"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pae:PA1626 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39998"
FT                   /db_xref="GOA:D3Q328"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q328"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD39998.1"
FT                   /translation="MSRVHDRPLAPPGPALLGFAALAMFVAALNLRPALAAVSPLVDAI
FT                   RSDLGLSATGVALLTTIPTLAMGLFAPFAASVARRFGPRHGVALGLAVIAVGTAARGLG
FT                   GAAWLQLSCAAAVGAGIAIAQTLLPAIVKARFAARPGLATGVYTAGLGLGGAIAAGVSA
FT                   PLAATIGSWHGALASWSVLAVVGIAVWLTARPALGPDPATTTAGPATRGLPWRDRTAWR
FT                   VTVLAAANSALYYCELAWVAALLHDDADRTAVDAGVLLTVLIAIQVVAMLAVPAILGEA
FT                   RDIRFGLTLTTAATALGFAGLALAPATLTWLWIVVLGIGHGGLFTLVLTVPVVISRDAA
FT                   EAGRISAMAFFVGYACAALAPMLVGGLRDALGDFQLAFALLSGLAVATLLPISKLRPTG
FT                   G"
     atgtcccgtg tccacgaccg cccgctcgcc ccgccgggcc cggccctgct cggcttcgcc        60
     gcgctggcga tgttcgtcgc cgcgctcaac ctgcgccccg cgctggccgc cgtctccccg       120
     ctcgtcgacg ccatccgctc cgacctgggc ctgtcggcca ccggcgtcgc cctgctcacc       180
     acgatcccga cgctggccat gggcctgttc gccccgttcg cggcctcggt cgcgcgtcgg       240
     ttcggcccgc ggcacggcgt cgcgctcggc ctggccgtca tcgccgtagg caccgccgcc       300
     cgcgggctgg gcggcgcggc ctggctgcaa ctgagctgcg cggccgccgt cggcgccgga       360
     atcgccatcg cccagacgct gctgcccgcg atcgtcaagg cccgtttcgc cgcccgtccg       420
     gggctggcca ccggcgtcta caccgccgga ctcgggcttg gcggcgcgat cgccgccggg       480
     gtcagcgctc cgctggccgc cacgatcggt tcctggcacg gcgccctggc ctcgtggtcg       540
     gtgctggccg tggtcggcat cgcggtgtgg ctgaccgccc ggcccgccct gggccccgat       600
     cccgcgacca ccaccgccgg acccgcgacc cgtggcctgc cctggcgtga ccggaccgct       660
     tggcgggtaa cggttctggc ggcggcgaac tcggcgctct actactgcga gctcgcctgg       720
     gtggcggcac tcctccacga cgacgccgac cgcaccgccg tcgacgccgg ggtgctgttg       780
     accgtgctga tcgcgatcca ggtcgtcgcc atgctcgccg tcccggcgat cctgggcgag       840
     gcgcgcgaca tccgcttcgg cctgacgctc accacggcgg cgaccgcgct gggcttcgcc       900
     gggctggccc tcgcgcccgc gacgctgacc tggctgtgga tcgtcgtcct gggcatcgga       960
     cacggtggac tgttcacact cgtcctcacc gtgccggtgg tgatcagtcg cgacgccgcc      1020
     gaggccggac ggatcagcgc gatggccttc ttcgtcggct acgcctgcgc cgcgctggcg      1080
     ccgatgctcg tcggcggcct gcgcgatgcc ctcggcgact tccagctggc gttcgcgctg      1140
     ctcagcggcc tggccgtcgc gacgctgctg cccatatcaa agctgcgccc gaccgggggc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page