(data stored in SCRATCH zone)

EMBL: CP001778.PE277

CP001778.PE277       Location/Qualifiers
FT   CDS_pept        complement(294626..295891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0282"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cco:CCC13826_0670 ProP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40000"
FT                   /db_xref="GOA:D3Q330"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q330"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40000.1"
FT                   /translation="MGVVSVKKSVVLLSLGHACVDVYQGAVAALVPFFIAERAYSHAAV
FT                   AGVVLAASLLSSVAQPLFGAVTDRRALPWLLPVSTIVGGVGIALSGVSGSYAVTLAFVA
FT                   VSGIGVAAYHPESARVARIASRGSHTAMSWFSLGGNVGFALAPLLVTAVVATGGLRFTP
FT                   LLVLPALAGSVLCLPVLRGLAASAANGSVAAQAKRPDDRGSFVKLSIAVVGRSITFVGL
FT                   STFIAVYAQERVGGGVLAGTIALFTLYVGGAVGTILGGRLANRWDRVTVVRYAYLVAVV
FT                   AVAGVVFVPGPAFYLFVAATSAGLYVPFSLQVTLGQDYLPSRVGTASGITLGLTITIGG
FT                   LASPLIGGLADATSLRVALAPLIAMPVLSWLMFRTLPEPAVMGADGSDGRQPAPDVGHR
FT                   GAVAVGVDAPGQVGDGDARQRS"
     atgggcgtcg tgtccgtgaa gaagtccgtt gtcctgctgt cgttggggca cgcgtgtgtg        60
     gatgtgtacc agggggcggt ggccgcgctg gtgccgttct tcatcgccga gcgcgcgtac       120
     tcgcacgcgg cggtggccgg ggtggtgttg gcggcgtcgc tgttgtcgtc ggtggcgcag       180
     ccgctgttcg gcgcggtgac ggatcggcgg gcgctgccgt ggctgctgcc ggtgagcacg       240
     atcgtcgggg gtgtggggat cgcgttgtcc ggggtgagcg gttcgtacgc ggtgaccttg       300
     gccttcgtcg cggtgtcggg gatcggggtg gcggcgtacc acccggagtc ggctcgggtg       360
     gcgcggatcg ccagccgggg cagtcatacg gcgatgagct ggttctcgtt gggcggcaac       420
     gtgggtttcg cgctcgcacc gctgctggtg acggcggtgg tggcgacggg tgggttgcgg       480
     ttcacgccgt tgctggtgct gcccgcgttg gccgggagcg tgttgtgcct gccggtgctg       540
     cgggggctgg cagcgtcggc ggcgaacggt tcggttgcgg cgcaagcgaa gcggccggac       600
     gaccgaggtt cgttcgtgaa gctgtcgatc gcggtggtcg gccggtcgat caccttcgtg       660
     gggctgagca cgttcatcgc ggtgtacgcg caggagcgcg tcggcggcgg ggtgctggcc       720
     gggacgatcg cgttgttcac gctgtatgtg ggcggggcgg tgggcacgat cctcgggggc       780
     cggctcgcca accgctggga tcgggtcacg gtggtgcggt acgcctacct ggtggcggtc       840
     gtcgcggtgg cgggcgtggt gttcgtgccg ggtccagcgt tctacctgtt cgtggcggcg       900
     acctcggcgg ggctgtacgt gccgttctcg ttgcaggtga cgctgggcca ggactacctg       960
     cccagccggg tgggcacggc gagcggcatc acgctgggcc tgacgatcac gatcggcggg      1020
     ctggccagtc cgctcatcgg cgggctcgcc gacgcgacct cgctgcgggt ggcgttggcg      1080
     ccgctgatcg cgatgccggt gctgagctgg ctgatgttcc ggacgctccc ggagcctgcg      1140
     gtgatggggg ccgatggctc agacggccgc cagccagccc cggacgtcgg ccatcgcggt      1200
     gccgtcgctg tcggcgtcga tgccccgggc caggtcggcg atggtgatgc gcgacagcgc      1260
     tcgtga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page