(data stored in SCRATCH zone)

EMBL: CP001778.PE28

CP001778.PE28        Location/Qualifiers
FT   CDS_pept        complement(36691..37593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39751"
FT                   /db_xref="GOA:D3PTZ3"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39751.1"
FT                   /translation="MNELKPRAFWWAAAVGVLLTTVVATTLSTIALASGNTETAQLWID
FT                   IVTRSLTVTAGLGGAFALWLAFRRQRHTERDAVNRRTTELRIQAIEQLGSDKPIVRIGG
FT                   LHNLEALAQGNSGLQEIVLEEICTYLRMPFYEPHDTENYDIKELWGVTQEREARRTAQH
FT                   ILERHLKPDGPYEYWDHDQLNLRQAALNDLNLRGCRLNNADFAAAELGGITDFRDAAFR
FT                   GDTTSFTMTEFDAAWFDNALFTAVARFHDTIFTQPPNFTGAAATRDDSVEHVWPNGWHL
FT                   DPNSDSTGFHQITKDELAE"
     gtgaatgaac tcaagccccg tgccttttgg tgggccgctg cagtcggcgt cctcctcacc        60
     acagtggttg ctaccacctt gtcgaccatc gcacttgcca gcggtaacac tgagacagcc       120
     caactgtgga ttgacatcgt gacccggtcc ttgacagtca ccgcagggct cggcggggca       180
     tttgcgttgt ggctagcgtt ccggcgacaa cgccacacgg agcgagacgc cgtaaaccgg       240
     cgtaccacag agctacgtat tcaagctatc gagcaactcg gatccgataa accgatcgtg       300
     cgcatcggtg gtctccacaa cttggaagca ctcgctcagg gaaactccgg tctacaagag       360
     attgtgctcg aagagatctg cacctatctg cggatgccgt tctacgagcc ccacgacacc       420
     gagaactacg acatcaagga actgtggggg gttactcagg aacgcgaagc acgacgcacc       480
     gctcaacaca tcttggaacg tcacctcaaa cctgatggcc catacgaata ctgggaccac       540
     gaccagctca atctacggca agccgctctc aatgacctga acctgcgagg gtgccgccta       600
     aacaatgccg atttcgccgc cgccgaacta ggtggcatca ccgacttccg ggatgccgcc       660
     ttccgtggtg atacaacctc gttcaccatg acagagttcg atgccgcttg gttcgacaac       720
     gcactattca ccgcggtagc gcgcttccac gacaccatct tcactcagcc tcccaacttc       780
     accggagccg cagctacacg cgatgacagc gtcgagcatg tctggcccaa cggatggcac       840
     ctcgatccca attcagactc gacaggattc caccaaatca caaaagacga actcgccgaa       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page