(data stored in SCRATCH zone)

EMBL: CP001778.PE294

CP001778.PE294       Location/Qualifiers
FT   CDS_pept        complement(311390..311992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0299"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="KEGG: mrd:Mrad2831_2146 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40017"
FT                   /db_xref="GOA:D3Q347"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q347"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_2146"
FT                   /protein_id="ADD40017.1"
FT                   /translation="MNTPVAAHRHAAVILAGGAATRMGGVPKPELTLGGRSLVRRVLDA
FT                   VPQASPRVVVGEVVARDFIVTAEDKPGSGPAYALAAGLAYVPDGVPLVVALAGDMPFLT
FT                   PELTAALCEAVKGDSDGAVLVDHNGRRQWLCGVWRRQVLAERLAGAAPGSGVRQLLGGA
FT                   RIVDVSWLDDDLPPWFDCDTPAALAYARQLEREFRRH"
     atgaacacac cagtagccgc gcatcggcac gccgccgtca tcctcgccgg gggtgcggcc        60
     acccgtatgg gtggggtgcc caagccggag ttgaccttgg gtggacggtc gctggtgcgg       120
     cgggtgctgg acgcggtgcc gcaggcgagc ccgcgggtgg tggtcggcga ggtggtggcg       180
     cgggatttca tcgtcaccgc cgaggacaag ccgggttcgg gtccggctta cgcgttggcc       240
     gccgggttgg cgtatgtgcc cgacggggtg ccgctggtgg tggcgttggc cggtgacatg       300
     ccgttcctga cgccggagtt gaccgccgct ttgtgtgagg cggtcaaggg ggacagtgac       360
     ggtgccgtgc tggttgacca caatggtcgt cggcagtggc tgtgtggggt gtggcggcgt       420
     caggtgctgg ccgagcgctt ggctggggcg gcgccgggtt cgggtgtgcg gcaactgctc       480
     ggtggggcgc gcatcgtcga tgtgtcctgg ctggacgacg atctgccgcc gtggttcgac       540
     tgcgacactc cggccgcgct ggcgtacgcg cggcagctgg agcgggagtt ccggcgccac       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page