(data stored in SCRATCH zone)

EMBL: CP001778.PE297

CP001778.PE297       Location/Qualifiers
FT   CDS_pept        complement(314106..315137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40020"
FT                   /db_xref="InterPro:IPR025447"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q350"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40020.1"
FT                   /translation="MTPSCEPPTEPDAADISLSTPMDLLSAIPYLVGYIPADSLVLVGL
FT                   DAKQITATLRVDLPRTDQPVTKLRISPDVLRRNKVEAAVIAGYGPPERVTRCVDHLRRM
FT                   LAAQNIELVDALRVTDGTFWSYVCQEPACCPPEGRPVNPGDSPVDAAFTYAGMRALPHR
FT                   QAVTAQLEPVKGPTRAAVTRATNQVRKLLDDTDAMFSARETLLDEARTILAKATEAGAP
FT                   LPEIDQTVRLAAALTDAKLQTEAMTLVDSHSPHKMVDLWLWVTRHVAPAFRARPAALLG
FT                   FAAWRCGNGVLATEAVRRSLTDDPHCPLAMVLGRLLDEGVPPSSIPKITGELLLPLPCS
FT                   PAG"
     atgacacctt catgcgagcc acccaccgaa cccgacgcgg ccgacatcag cctctccacc        60
     cccatggacc tgttgtccgc catcccctac ctggtcggct acataccggc cgacagcctc       120
     gtcctggtgg gcctggacgc caagcagatc acggccaccc tgcgggtcga cctgccccgg       180
     accgaccaac ccgtcaccaa actgcgcatc tcccccgacg tcctacgccg caacaaggtc       240
     gaagccgccg tgatcgccgg ttacggcccg cccgaacggg tcacccgctg cgtcgaccac       300
     ctccgccgca tgctggcggc gcagaacatc gagctcgtcg acgcgctgcg cgtcaccgac       360
     ggcaccttct ggtcctacgt ctgtcaggaa cccgcgtgct gcccgccgga gggcaggccg       420
     gtcaaccccg gcgactcccc ggtcgacgcg gccttcacct acgcgggcat gcgggcccta       480
     ccgcaccgcc aagccgtcac cgcccagctg gaaccggtca agggccccac ccgagccgcc       540
     gtcacccggg ccaccaacca ggtacgcaaa ctcttggacg acaccgacgc catgttctca       600
     gcccgcgaga ccctgctcga cgaggcccgg accatcctcg ccaaagccac cgaggcgggt       660
     gccccgctgc cggagatcga ccaaacggtg aggctggccg cggcgctgac cgacgccaag       720
     ctccagaccg aggcgatgac tttggtcgac agccacagcc cgcacaagat ggtcgaccta       780
     tggctgtggg tgacccgcca tgtggccccc gccttccgag cccggcccgc ggcgttgctg       840
     gggttcgccg cgtggcgctg cggcaacggc gtgctggcca ccgaggcggt gcgccgatcc       900
     ctcaccgacg acccgcactg tccactggcg atggtgctcg gtcgcctgct ggacgagggc       960
     gtgccaccgt cctcgatccc gaagatcacc ggcgaactgc tgctgccact gccctgctcc      1020
     ccggccggat ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page