(data stored in SCRATCH zone)

EMBL: CP001778.PE298

CP001778.PE298       Location/Qualifiers
FT   CDS_pept        complement(315510..316430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0303"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: lhk:LHK_00425 TrmB; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40021"
FT                   /db_xref="GOA:D3Q351"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q351"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADD40021.1"
FT                   /translation="MSTIEPSSSIRSFYRRRGKVRPSKLDAYDRLYPVLGVDRQQPPPL
FT                   PEIFGRTAPVVLEIGSGMGDATVAMAAADPDRDYLAVEVHVPGIANLMMRAEEHELTNL
FT                   RVFEGDAVSLARSCLPADTLDAIHVFFPDPWPKARHHKRRLISPENVALLRSRLRRGGA
FT                   FHLATDWEHYAESMLEVLDADPGLSNAHDGFAPRPDWRPVTKFERRGIAEGRQIFDLEF
FT                   VRPEQPLSLGILAHGPQTLVPSRCRRRAARDLRVLCDHSQLGGDRRHGQARDDRTGARH
FT                   RRQLLQRHGQGLQLLRGFVDAVGRQ"
     gtgagcacca tcgagccctc gtccagcatc cgcagcttct accggcggcg cggcaaggtg        60
     cgtcccagca agctggacgc ctacgaccgg ctgtacccgg tcctcggggt ggaccggcag       120
     cagccgcctc cgctgccgga gatcttcggc cgcacggcgc cggtggtcct ggagatcggt       180
     tccgggatgg gcgacgcgac cgtcgcgatg gccgccgccg accccgaccg cgactacctc       240
     gccgtcgagg tgcacgtgcc cggcatcgcg aacctgatga tgcgcgccga ggaacacgaa       300
     ctgaccaatc tgcgggtctt cgagggcgac gcggtgtcgc tggcacgttc ctgccttccg       360
     gccgacactt tggacgcgat ccacgtcttc ttccccgacc cgtggcccaa ggcccggcac       420
     cacaagcgcc gcctgatctc gcccgagaac gtggcgctgc tgcggtcccg gctgcggagg       480
     ggcggggcgt ttcacctggc cacggactgg gagcactacg ccgagtccat gctggaggtg       540
     ctcgacgccg accctggcct gtccaacgcc cacgacggtt tcgccccccg tccggactgg       600
     cggccggtca ccaagttcga acgccggggc atcgcggagg gccgtcagat cttcgatctg       660
     gagttcgtcc ggccggaaca gccgttatcg ctgggcatac ttgcgcatgg cccgcaaacc       720
     ctggtcccgt ctcgctgtcg gcgtcgggct gctcgcgatc ttcgcgtcct gtgtgatcac       780
     tcccagctgg ggggcgatcg acggcacggt caagctcgcg acgaccgaac cggtgcacgt       840
     caccgacgtc agctgcttca acggcacggc caggggctcc agctactgcg cgggttcgtg       900
     gacgctgtcg gacggcagta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page