(data stored in SCRATCH zone)

EMBL: CP001778.PE304

CP001778.PE304       Location/Qualifiers
FT   CDS_pept        complement(320978..321226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40027"
FT                   /db_xref="GOA:D3Q357"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q357"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40027.1"
FT                   /translation="MPGPTYDTPWPYFYGLGAALLVFSAVYLLDDWIETHLGFVASVLA
FT                   VAKRQTSQPAEPFKVLASRRWCSWACSSPWSGGRSSC"
     atgccggggc ccacctacga cacgccctgg ccgtacttct acggactcgg cgccgcgctg        60
     ctggtgttca gcgccgtcta cctgctggac gactggatcg agacccacct cgggttcgtc       120
     gcctccgtgc tggccgtcgc gaagcggcag acctcgcaac cggccgagcc gttcaaggtg       180
     ctggcctcgc gtcgctggtg ttcctgggcg tgctcatcgc cgtggtcggg cggccgttcc       240
     agctgctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page