(data stored in SCRATCH zone)

EMBL: CP001778.PE33

CP001778.PE33        Location/Qualifiers
FT   CDS_pept        complement(43979..44374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39756"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39756.1"
FT                   /translation="MTSEIRLDKRALREFISLMDQTAEEMADIQDGTTPRYARSGGGGE
FT                   AAYRNGVKVTVGSVDFAHPGRVAGELMADRIAETLEFVRSLEEGSRALARIVRSVLDDM
FT                   GARDSIAASDLARINNSMEGRSRGDQL"
     gtgaccagcg agatcagact cgacaaacga gccctgcgcg agttcatctc cctcatggac        60
     caaaccgccg aggagatggc cgacatccag gacggcacca cgccgcgcta cgcccgcagt       120
     ggtggcgggg gtgaggccgc ctatcgcaac ggggtgaagg tgaccgttgg ttcggtggac       180
     ttcgcgcacc ccggacgggt cgccggtgaa ctcatggccg accggatcgc cgagacgctc       240
     gaattcgttc gcagcctgga agagggctcg cgggcgctcg cgcggatcgt tcggagtgtg       300
     ctcgacgata tgggcgcccg ggacagtatc gccgcgtccg atctggcccg tatcaacaac       360
     tcgatggagg gacgctcccg tggggaccag ttatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page