(data stored in SCRATCH zone)

EMBL: CP001778.PE343

CP001778.PE343       Location/Qualifiers
FT   CDS_pept        351953..352327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40066"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q396"
FT                   /inference="similar to AA sequence:KEGG:Bpet0944"
FT                   /protein_id="ADD40066.1"
FT                   /translation="MAPIRSEDRHRYPKDWKQISARIRHGRAAGRCECDGICGTGHTGR
FT                   CPARQHHRHPVTGSKVVLTVAHLDRTPEHCDDDNLAAMCQRCHLAYDAEQHASNAARTR
FT                   FRNATAGMEPLFGLDITTGA"
     atggcaccca ttcgatctga agaccggcac cgctacccga aagactggaa gcagatctcg        60
     gcacgcatcc gccacggccg cgccgccggc cgctgtgaat gcgacggcat ctgcggtact       120
     gggcacaccg gccgctgccc ggcccgccag caccaccgac accccgtcac tgggtcgaag       180
     gtcgtgttga cggtggccca tcttgaccgc acccccgaac actgcgacga cgacaatctc       240
     gccgcgatgt gccaacgctg ccatctggca tacgacgccg aacagcatgc gtccaacgcc       300
     gcccgcaccc gattccgcaa cgccacggca ggcatggaac cgctattcgg cctcgacata       360
     accaccggcg cgtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page