(data stored in SCRATCH zone)

EMBL: CP001778.PE363

CP001778.PE363       Location/Qualifiers
FT   CDS_pept        complement(376461..377273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40086"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40086.1"
FT                   /translation="MRVTGVSTPTRPFRDNEDWLGSGPGVVVVLDGCGQPDNIAEDTER
FT                   GCAHGLPWYVKTLGTAVLRSAGDLATPLDDALATAIAETATAHHGRCDLHHPSTPASTV
FT                   VILRENRRTVEYLVLGDSTIAIDDGSPEPIVVTDDREIRIPFPSIGSDEEQAKRNTREY
FT                   MAVVEKLRNQPDGFPIAAADPQAAYRALAGHLGTEQVRRAIVASDGATRLVDRFGILTW
FT                   TELLDLASSGGPEEVINQTRTAETTDLECKKWPRGRAHDDATLALCVF"
     gtgagagtca ccggagtttc caccccgacc cggccgttca gggacaacga ggactggctt        60
     ggctctggtc cgggtgttgt cgtcgttctc gacggttgcg gacagccgga caacatcgcc       120
     gaggacaccg agcgtggttg cgcgcacggg cttccgtggt acgtcaagac gctggggacc       180
     gcggtgctgc gcagtgccgg ggatctggcg acgccgctgg acgacgcgct ggccaccgcc       240
     atcgccgaga ccgcgaccgc tcaccatggg cggtgcgatc tgcaccatcc gtcgacgccc       300
     gcctcgacgg tggtgatcct gcgggagaac cgtcgcacgg tggagtacct ggtgttgggg       360
     gattcgacca tcgccatcga cgacggcagc ccggagccga tcgtggtcac cgacgatcgg       420
     gagatccgga tcccgtttcc gtccatcggg tcggacgaag agcaggcgaa acgcaacacg       480
     cgggagtaca tggcggtggt ggagaagctg cgcaaccagc cggacgggtt cccgatcgcc       540
     gccgctgatc cgcaggccgc gtatcgggcg ctggccgggc acctgggtac cgagcaggtg       600
     cggcgggcga tcgtggccag cgacggggcg acccggctgg tggaccgttt cgggatcctg       660
     acctggaccg agttgctgga cctggccagt tcgggagggc cggaagaggt catcaaccag       720
     acccgcacgg ccgagaccac ggatctggag tgcaagaagt ggccacgtgg gcgcgcgcac       780
     gacgacgcga cgctcgcgtt gtgcgtgttc tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page