(data stored in SCRATCH zone)

EMBL: CP001778.PE365

CP001778.PE365       Location/Qualifiers
FT   CDS_pept        378554..379072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40088"
FT                   /db_xref="GOA:D3Q4C8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40088.1"
FT                   /translation="MTGEEYLHSYDPDNSVPGSLSYFTHRFAAMAKRSGFHCTPQKVRH
FT                   FSATKLLAAKIALPAVAGRLGHSSGGRTTLQYYAAWLRETDDSAVRVLAACMPELPQVR
FT                   REKSRRDFSAEQPTRTKDELEARICNIRREEGLGPVKIQARLAAEGTDIASSAVWLVLK
FT                   RHGLNKAVG"
     atgaccgggg aggagtactt gcactcgtat gaccctgaca actcggttcc gggctcgctg        60
     tcgtacttca ctcaccgatt cgcggcgatg gcgaagcggt cgggttttca ctgcacgccg       120
     caaaaggtcc ggcatttcag cgcgacaaag ctgttggccg ccaagatcgc cctacctgcc       180
     gtggcgggac gcctcgggca cagctcaggt ggaaggacca cgcttcagta ctacgcggcg       240
     tggttgcgcg agacggacga ctccgctgtc cgtgtgctcg ccgcctgcat gccagagctg       300
     ccgcaggtgc gtcgtgaaaa atcgcgccgc gacttctctg ctgagcaacc aacacgcacg       360
     aaggacgaac tcgaagcgcg catctgcaac atccgtcgtg aagaaggact aggaccggtg       420
     aagatccaag ctcggctggc tgccgaagga acagacatcg cctcttccgc ggtgtggctg       480
     gtgttgaagc ggcatggtct gaacaaggcg gttggctag                              519
//

If you have problems or comments...

PBIL Back to PBIL home page