(data stored in SCRATCH zone)

EMBL: CP001778.PE367

CP001778.PE367       Location/Qualifiers
FT   CDS_pept        complement(379925..380515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0373"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: dal:Dalk_5036 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40090"
FT                   /db_xref="GOA:D3Q4D0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D0"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADD40090.1"
FT                   /translation="MKGQGVSELAGEAGYLLEIGLLKRTRRTGWWIAGIRDPESIAEHS
FT                   WRTAITGMIIASHEGADPARTSMLCSLHDTPETRIGDIPKIGKHYLKATAPDTIAADQT
FT                   AKCSDQAGQVIRDAIAEFEAGQTPEALCAKDADKLECLIQAVEYQHQGVSTVTRWIESS
FT                   LAALKTDTARGLADEILKANPLAWEQTRRPSAT"
     atgaaaggcc aaggcgtgag cgaacttgct ggtgaagcgg gatacctgct cgaaatcggg        60
     ctactgaaac gcactcgccg caccgggtgg tggatcgcag gtatccgtga ccccgaaagc       120
     atcgccgaac acagctggcg caccgcgatc accggaatga tcatcgccag ccacgaaggc       180
     gccgaccctg cacgcacatc catgctgtgc tcactgcacg acaccccgga aacccgcatt       240
     ggcgacattc ccaagatcgg caagcactac ctcaaagcaa ccgctcccga cactattgcg       300
     gccgaccaaa ccgccaaatg ctccgaccaa gccggacaag tcatacgcga cgcgatagcc       360
     gaattcgaag caggccagac gccagaggct ttgtgcgcca aagacgccga caaacttgaa       420
     tgtctcatcc aagcagtcga ataccagcac caaggagttt ccaccgttac gcgctggatc       480
     gaaagcagtc ttgccgcgtt gaaaaccgac acggctcgtg gactggctga tgagattctg       540
     aaagccaacc cacttgcttg ggaacaaacc cgtcgccctt cagcgacgta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page