(data stored in SCRATCH zone)

EMBL: CP001778.PE37

CP001778.PE37        Location/Qualifiers
FT   CDS_pept        complement(46412..47410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3324 protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39760"
FT                   /db_xref="GOA:D3QC40"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39760.1"
FT                   /translation="MDEPTPARGRLKAAWTLIILVPICAELTFTAVAVPLTWLALPLLI
FT                   PIYGAGVLLIREATVRVGGGWPSLVVLGLAYELAEDGLGLQALTSPNMYDVSDWSLRVL
FT                   GLNLTYWESQIGIHVVFSVLLPLMLMDLLFPHHKNRPYLRTGGLITTAVTAILGVALLR
FT                   FTIAAAQDPGYQTPTSALIGFTLTIATLAFIALKLLPGRTPSAKPLPIAPVPVGVLAAA
FT                   ATIGFLGLLMPFGLAPGGPVFGDTIPLWLPLIGSALIAIATTWLIRRWTAAPTWSDTHR
FT                   LWLAGGALVAHTAFMMPGQPLPGQLTGAATIAVEIVALFLLSRILKRRTTL"
     atggacgagc caacaccggc acggggaaga ctgaaagccg cctggaccct catcatcctg        60
     gtcccgatct gcgcggaact gaccttcacg gcggtcgccg tccccctgac ctggctggcc       120
     ctccccctat tgatccccat ctacggcgcg ggcgtcctgc tgatccgcga ggccaccgtc       180
     cgggtcggcg gcggctggcc cagcctcgtc gtcctcggcc tcgcctacga actcgccgag       240
     gacggtctgg gcctacaagc tctgaccagc ccgaacatgt acgacgtctc cgactggagc       300
     ctacgagtac tcggcctcaa cctcacgtac tgggaatccc agatcggcat ccacgtcgtc       360
     ttcagcgtcc tgctccccct gatgctgatg gacctgctgt tcccacacca caagaaccgc       420
     ccctacctcc gcaccggcgg cctcatcacc accgccgtca ccgcgatcct cggcgtcgcc       480
     ctactccggt tcaccatcgc cgcagcccag gacccgggct accaaacccc cacatcggcc       540
     ctcatcggtt tcaccctcac catcgcgacc ctcgccttca tcgcactgaa actcctccct       600
     ggccgaaccc cttcggcaaa acccctcccg atcgccccgg taccggtcgg agtactcgcg       660
     gcggcggcga ccatcggctt cctgggtctg ctgatgccct tcggtctggc ccccggcggc       720
     ccggtcttcg gcgacacgat ccccctatgg ctgccgctca tcggttccgc cctcatcgcg       780
     atcgccacca cctggctgat ccgccgctgg accgccgccc cgacctggag cgacacccac       840
     cgcctctggc tggccggagg cgccctggtc gcccacacgg cgttcatgat gcccggccaa       900
     ccgctcccgg gccagctcac cggcgccgcg acgatcgccg tcgagatcgt cgcgctgttc       960
     ctgttgtccc gcatactgaa gcgccgcacc acgctctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page