(data stored in SCRATCH zone)

EMBL: CP001778.PE376

CP001778.PE376       Location/Qualifiers
FT   CDS_pept        388166..388696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40099"
FT                   /db_xref="GOA:D3Q4D9"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40099.1"
FT                   /translation="MKKWYNSLSPGEQFGAVVGGTVGALIFLFAMCGFVGVLADSDGTN
FT                   VSHVGASTSASASESPTASSPSASSKSPSPEPSTSSEKPSPKPSKSESPSPPPKPDLCG
FT                   APQNPYGYNYCGTGGVVHDPPGDICFYFECIDYFDEGKGYMVACDDGMVSMSGGRSGAC
FT                   SYHGGVGRTVYGG"
     atgaagaagt ggtataactc gctctcaccg ggtgaacagt tcggtgccgt agtgggcggg        60
     accgtgggcg ctctcatttt cttgttcgcc atgtgcggtt tcgttggagt cttggcagat       120
     tcggacggga cgaacgtcag tcatgtgggc gcaagcacca gcgcgagtgc atcggaatcg       180
     ccaaccgcat cctctccatc cgcctcgtcg aagtcgccct cgcccgagcc gtcgaccagc       240
     agcgagaagc cgtcgcccaa gccgagcaaa tccgaatcgc cgtcgccgcc tcccaagccc       300
     gatctgtgtg gcgcgcccca gaacccatac ggatacaact actgcggcac gggcggagtc       360
     gtgcacgatc cgccaggtga tatctgtttc tacttcgagt gcatcgacta cttcgacgag       420
     ggcaagggct acatggtcgc gtgcgacgac ggcatggtca gcatgtcggg cggccgttca       480
     ggagcctgtt cgtatcacgg cggtgtgggc cgcactgttt atggcggttg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page