(data stored in SCRATCH zone)

EMBL: CP001778.PE381

CP001778.PE381       Location/Qualifiers
FT   CDS_pept        complement(391337..391948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0387"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mlo:mlr8191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40104"
FT                   /db_xref="GOA:D3Q4E4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADD40104.1"
FT                   /translation="MSIEFLLTTLVVVATPGTGVVYTLAAGLSRGAKASLIAAVGCTLG
FT                   IVPHMIAAVTGLAALLHASATAFEIIKYAGVAYLLYMAWATIRDKGALTVEADTAPQST
FT                   LRVIGSGVLVNILNPKLTIFFFAFLPQFVPAGAPNALPRMLGLSAVFMLATLAVFALYG
FT                   VFAAAVREHVISRVRVMTWLRRTFAASFVVLAGRLALTER"
     atgagcatcg aattcctgct gacaaccctc gtcgtcgtcg ccacccccgg caccggcgtc        60
     gtctacaccc tggccgccgg actgtcccgc ggcgccaagg ccagcctcat cgccgccgtc       120
     ggctgcacgc tgggcatcgt cccccacatg atcgccgccg tcaccggcct ggccgcgctg       180
     ctgcacgcca gcgccaccgc gttcgagatc atcaagtacg cgggcgtggc ctacctgctg       240
     tacatggcct gggcgaccat cagggacaag ggagccctca ccgtcgaggc cgacaccgcc       300
     ccgcagtcga cactgcgggt catcggctcg ggcgtcctgg tcaacatcct caaccccaag       360
     ctgacgatct tcttcttcgc gttcctgccc cagttcgtcc ccgccggggc acccaacgcg       420
     ctgccgcgga tgctgggtct gtcggccgtg ttcatgctcg cgaccctcgc ggtgttcgcc       480
     ctctatggag tgttcgccgc agccgtacgc gaacacgtca tctcacgggt tcgcgtcatg       540
     acctggctgc ggcgcacctt cgcggcgtcc ttcgtggtgc tcgcgggacg gctggccctg       600
     accgaacgct ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page