(data stored in SCRATCH zone)

EMBL: CP001778.PE382

CP001778.PE382       Location/Qualifiers
FT   CDS_pept        392187..392771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40105"
FT                   /db_xref="GOA:D3Q4E5"
FT                   /db_xref="InterPro:IPR000013"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40105.1"
FT                   /translation="MTERSRLLRRGVLAAFGVGALLAIASPALATAQPVADTASETKAV
FT                   TLTYDTSQAEEFVQDVHDGAKVWNDNVENVTLEPVADGQTADFEVIATDGWPQASVPEL
FT                   GKGTIEFGRQAVDEGHNTTRISAHEIGHILGLPDVKPGPCSSLMSGASAGTDCDNAIPN
FT                   AEEKAEVESNFGSGMAAKSKTWRDMYFCDKD"
     atgactgaaa gatcacgtct cctccgacga ggggtgctcg ccgcgttcgg cgtcggcgcc        60
     ctgctggcga tcgcctcccc ggcactggcg accgcccagc ccgtcgcgga cacggcctcc       120
     gagaccaagg ccgtcaccct cacctacgac accagtcagg ccgaggagtt cgtccaggac       180
     gtccacgacg gcgccaaggt ctggaacgac aacgtcgaga acgtgacgct cgaaccggtg       240
     gccgacggtc agaccgccga cttcgaggtc atcgcgaccg acggctggcc gcaggcctcg       300
     gtgcccgagc tcggcaaggg caccatcgag ttcggccgtc aggccgtcga cgagggccac       360
     aacaccaccc ggatctccgc gcacgagatc ggccacatcc tggggctgcc ggacgtcaag       420
     cccggaccct gctccagcct gatgtcgggc gcctcggcgg gcaccgactg tgacaacgcg       480
     atccccaacg ccgaggagaa ggccgaagtg gagtccaact tcggctccgg catggccgcc       540
     aagtcgaaga cctggcgcga catgtacttc tgcgacaagg actga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page