(data stored in SCRATCH zone)

EMBL: CP001778.PE383

CP001778.PE383       Location/Qualifiers
FT   CDS_pept        complement(392827..394368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0389"
FT                   /product="sodium/proline symporter"
FT                   /note="TIGRFAM: sodium/proline symporter; SSS sodium solute
FT                   transporter superfamily; PFAM: Na+/solute symporter; KEGG:
FT                   hha:Hhal_0554 sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40106"
FT                   /db_xref="GOA:D3Q4E6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E6"
FT                   /inference="protein motif:TFAM:TIGR02121"
FT                   /protein_id="ADD40106.1"
FT                   /translation="MNANVPTLTTFLVYLLMMIAIGVWVYRRTHNLGDYVLGGRSLRPS
FT                   VAAMSAGASDMSGYLFLGVPGAVYAQGVGATWIAIGLILGTYFNWLFIAERLRTYTERA
FT                   KNSLSLSSYFENRFEDRTQLLRIISALVIVVFFTVYVSSGLVASAQLFHSVFGISLVTA
FT                   ATIGFIVVAVYTSIGGFLADSFTDFIQGTMMFLALLVLPMIGLWAIGGFAEVGSAVSEK
FT                   SPDLWNMGDVVAYENGAWGAGDALGFVAIVSGLSWGLGYFGMPHILARFMGIRSAKDVP
FT                   VARRIGTGWVILSLAGACAVGLLGIGLIDKPLDNPEDVFFALANQLTNPWIAGLLQAAL
FT                   LAAVMSTVDSQLIIVSTALTEDFYRKVNKRASDKQLLWVGRGGVVLVGIVAFVLALIAL
FT                   GSKNPADSSILLIVAHAWAGFGAAFGPVILLSLFWPRMTWVGALAGMVVGAVVALSWPT
FT                   LDEKFFGTGLYELVPGFALALLAAWGFGHLGRRPEREWKGKYEDYLPDEPEAAKP"
     atgaatgcca atgttccgac cctgacgact tttctcgtct atttgctgat gatgatcgcc        60
     atcggcgtgt gggtttaccg gcgtacccac aatcttggtg attacgtcct cggcggtcgc       120
     tccctgcggc cctcggtcgc ggccatgtcc gccggggcca gcgacatgtc gggttatctc       180
     ttcctcggcg ttcccggcgc ggtctacgcc cagggcgtcg gcgccacctg gatcgccatc       240
     ggcttgattc tcggcaccta tttcaactgg ctcttcatcg ccgagcggct gcgcacctac       300
     accgagcgcg ccaagaactc gctgagcctg tcgtcctatt tcgagaaccg cttcgaggat       360
     cggacgcagc tgctgcgcat tatctcggct ctggtgatcg tcgtgttctt caccgtctac       420
     gtctccagcg ggctcgtcgc ctcggcgcag ttgttccaca gcgtcttcgg catctcgctg       480
     gtcacggccg ccacgatcgg cttcatcgtc gtggccgtct acacgtccat cggcgggttc       540
     ctcgccgaca gcttcaccga cttcatccag ggcaccatga tgttcctggc gctgctggtg       600
     ctgcccatga tcggactgtg ggcgatcggc ggcttcgccg aggtcggatc cgcggtcagc       660
     gagaagtccc cggacctgtg gaacatgggt gacgtcgtcg cctacgagaa cggcgcgtgg       720
     ggagcgggcg acgcgctcgg cttcgtcgcg atcgtgtccg gcctgtcgtg gggtctgggc       780
     tacttcggca tgccgcacat cctggcccgg ttcatgggca tccggtccgc caaggacgtt       840
     ccggtggccc gccgcatcgg caccggctgg gtgatcctgt cgctggccgg ggcctgcgcg       900
     gtcggcctgc tggggatcgg gctcatcgac aaaccgctcg acaaccccga agacgtcttc       960
     ttcgcactgg ccaaccagct gacgaacccg tggatcgcgg gcctgctgca ggcggcgctg      1020
     ctggcggccg tcatgtccac ggtcgacagc cagttgatca tcgtctccac cgccctcacc      1080
     gaggacttct accgcaaggt caacaagcgg gcctccgaca agcagctgct gtgggtcggc      1140
     cgcggcggtg tcgtcctggt gggcatcgtc gcctttgtgc tggcgctcat cgccctgggc      1200
     agcaagaacc ccgccgactc ctcgatcctg ctgatcgtgg cccacgcctg ggcgggcttc      1260
     ggcgccgcct tcggcccggt gatcctgctg tcgctgttct ggccccggat gacctgggtc      1320
     ggggccttgg ccggaatggt cgtgggcgcc gtggtggcgc tgtcctggcc gacactggac      1380
     gagaagttct tcggcaccgg actgtacgaa ctggtcccgg gcttcgcgct ggcgctgctg      1440
     gccgcctggg gcttcggcca cctcggccgt cgtccggagc gggaatggaa gggcaagtac      1500
     gaggactacc tccccgacga acccgaagcc gccaaaccgt ag                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page