(data stored in SCRATCH zone)

EMBL: CP001778.PE385

CP001778.PE385       Location/Qualifiers
FT   CDS_pept        396164..397504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0391"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; SMART:
FT                   peptidase M14 carboxypeptidase A; KEGG: hch:HCH_04864
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40108"
FT                   /db_xref="GOA:D3Q4E8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E8"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ADD40108.1"
FT                   /translation="MKTRRKLISLLSAAAVVAAGTGLIVGSANADPGSDRNPGEQVAWK
FT                   VPGLTGKQATSLEDDGFDLVDYEDDGSAIVIGDEKVADKLRDKGMKPKFLDTIVKPVDK
FT                   DYKDTADTYYGGYHTVTAHEEHLDKVASEHSDLAKVYDIGDSWLKTKGEGGHDIKAICI
FT                   TKIADGDCEQKPDSKKPRFSMIAQMHAREIATGEVAWKFIDKLTTGYGQDDAVTKLLDS
FT                   TEVWVVPIANPDGVDIVASGGDNPILQRKNANDSAGDCGESKGVDLNRNSSFKWGDDSD
FT                   DPCAETYQGTAAKSEPETAGLEEWFQNIHPDQREDDPSSPAPNDARDTMITLHSYGQYI
FT                   IIPWGFTEDQSPNDAQLRALGEKMSESNGYKVGTNGDTVGYSTSGTTDDFTYGQLGVAS
FT                   FTFEMGADSGDCGGFLPVYECVDSTLWKENEGALMTAAEAAKAPYAE"
     atgaaaacaa gacgcaagct gatcagcttg ctcagcgccg ccgcggtcgt cgcggccggt        60
     accgggctga tcgtcggatc ggccaacgcc gatcctggtt ccgaccgcaa ccccggcgag       120
     caagtcgcgt ggaaggtgcc tggcctgacc ggcaagcagg ctacgtcact ggaggacgac       180
     ggcttcgacc tcgtcgacta cgaggacgac ggctcggcca tcgtcatcgg cgacgagaag       240
     gtcgccgaca agctccgcga caagggcatg aagcccaagt tcctcgacac gatcgtcaag       300
     ccggtcgaca aggactacaa ggacaccgcc gacacctact acggcggcta ccacaccgtg       360
     accgcgcacg aggagcacct cgacaaggtc gcgtccgagc actcggacct ggccaaggtc       420
     tacgacatcg gcgactcctg gctcaagacc aagggcgagg gcggccacga catcaaggcc       480
     atctgcatca ccaagatcgc cgacggcgac tgtgagcaga agccggactc caagaagccc       540
     cggttctcga tgatcgcgca gatgcacgcc cgcgagatcg ccaccggcga ggtggcgtgg       600
     aagttcatcg acaagctgac caccggctac ggccaggacg acgcggtcac caagctgctg       660
     gactccaccg aggtgtgggt cgtcccgatc gccaacccgg acggcgtgga catcgtggct       720
     tccgggggcg acaacccgat cctgcaacgc aagaacgcca acgactccgc cggtgactgc       780
     ggcgagagca agggcgtcga cctgaaccgc aactcctcgt tcaagtgggg cgacgactcc       840
     gacgacccgt gcgccgagac ctaccaggga acggccgcga agtccgagcc ggagaccgcc       900
     ggactggagg agtggttcca gaacatccac cccgaccagc gtgaggacga cccgtcctcg       960
     ccggcgccga acgacgcccg cgacacgatg atcaccctgc acagctacgg gcagtacatc      1020
     atcatcccgt ggggcttcac cgaggaccag tcccccaacg acgcccagct gcgggcgctg      1080
     ggggagaaga tgtccgagtc caacggctac aaggtcggca ccaacggtga caccgtcggg      1140
     tacagcacct ccggtaccac cgacgacttc acctacggcc agctcggcgt cgccagcttc      1200
     accttcgaga tgggcgccga ctccggcgac tgcggcggat tcctgccggt ctacgagtgc      1260
     gtcgacagca ccctgtggaa ggagaacgag ggagcgctca tgacggccgc cgaggccgcc      1320
     aaggctcctt acgcggaata a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page