(data stored in SCRATCH zone)

EMBL: CP001778.PE389

CP001778.PE389       Location/Qualifiers
FT   CDS_pept        complement(401229..401594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40112"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40112.1"
FT                   /translation="MPPPPPTDGRFEVDVDAIEDFQPTFNRLDSRVSTASGKVSPASAE
FT                   GLGTFTDAMTVIRDHDRLRATYLTRLEMLRAAVAIANTKTTRLIANYRGTESTETSNMT
FT                   ALLGPLANVIQQIARKD"
     atgccgcccc caccacccac cgacggccgt ttcgaggtcg acgtggacgc catcgaggat        60
     ttccagccca cgttcaaccg tctggactcc cgagtcagta ccgcctccgg caaggtctcc       120
     ccggccagcg ccgagggact gggcaccttc accgacgcga tgacggtcat ccgtgatcac       180
     gaccggttgc gggccaccta tctgaccagg ctggagatgc tgcgggccgc ggtcgcgatc       240
     gcgaacacca agaccactcg cctgatcgcg aactaccgcg gcaccgagtc caccgaaacc       300
     tcgaacatga cggcgctgct gggcccgttg gccaacgtca tccagcagat cgcgcgaaag       360
     gactga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page