(data stored in SCRATCH zone)

EMBL: CP001778.PE400

CP001778.PE400       Location/Qualifiers
FT   CDS_pept        complement(411453..412850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0406"
FT                   /product="secretion protein snm4"
FT                   /note="TIGRFAM: secretion protein snm4; PFAM: protein of
FT                   unknown function DUF571; KEGG: GK10816 gene product from
FT                   transcript GK10816- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40123"
FT                   /db_xref="GOA:D3Q4G3"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G3"
FT                   /inference="protein motif:TFAM:TIGR02958"
FT                   /protein_id="ADD40123.1"
FT                   /translation="MALTNQLCRVTVVAPNTRMDIALPDHVRLCDLQSDLLSHAAEGPG
FT                   GDDLLDDGADAGGWVLTRLGGAPLDPQLTPRQHDIVDGEELYLVPVTDTGPQAVFDDII
FT                   DAMATANQKRERKWRTGSSRRFGIGFAIAAILGSAVACVASGTTVAMWTATALCATALL
FT                   AALIFARALGRVTEAAVMGLLACGYALAAGVLALAPLATIADVSAPRLMVGGAAVAVIA
FT                   VASGIGVPTAAPIFSATAICGTALAGAAALCAFVDAAPAQAGSVAAAVVLGLIPAMPML
FT                   AFRVARLPMPTIPRSPQQLRADTNIVDSQMALRRSERADEHLSGLLTATAIISGTATVY
FT                   LALHGTLAAILLASLLTVLAFMRARIFPTVRQRLPFLLAATAGLAGLALSAWVHWPPEY
FT                   RFVLLVAGLVATAAIALGYVLGVAGKPIAPTWGRLVDILEVILFVAVVPLTLWVWDAYW
FT                   WVRTVNG"
     atggccctca cgaaccagct gtgccgggtc accgtcgtgg cccccaacac ccgcatggac        60
     atcgcgctgc ccgaccacgt gcggctctgc gacctgcaaa gcgatttgct gtcccacgcc       120
     gccgaaggcc cgggcggcga cgacctgctc gacgacggcg ccgacgccgg cggctgggtc       180
     ctgacccgcc tcggcggtgc tccgctcgac ccgcaactca ccccgcgcca gcacgacatc       240
     gtcgacggcg aggagctcta cctggtcccg gtcaccgaca ccggcccgca ggcggtcttc       300
     gacgacatca tcgacgcgat ggccaccgcg aaccagaaac gggaacgcaa gtggcgcacc       360
     ggctccagcc gccgcttcgg catcggcttc gccatcgccg cgatcctggg ctcggccgtc       420
     gcctgcgtcg cgtcgggcac caccgtcgcc atgtggacgg ccaccgccct gtgcgccacc       480
     gccctgctgg ccgccctgat cttcgcccgc gccctgggcc gggtcaccga agccgccgtg       540
     atgggcctgc tcgcctgcgg ctacgccctg gccgccggcg tactcgcgtt ggcgcccttg       600
     gcaaccatcg ccgacgtctc agcgccgcgc ctcatggtcg gtggcgccgc cgtcgcggtc       660
     atagcggtcg cgtccggcat cggcgtcccc accgccgccc cgatcttcag cgccaccgcc       720
     atctgcggca ccgccctggc gggcgcggcg gccctgtgcg ccttcgtcga cgccgccccc       780
     gcccaggccg gttcggtcgc ggcggccgtc gtcctgggcc tcatccccgc catgcccatg       840
     ctcgccttcc gggtggcccg cctccccatg ccgacgatcc cccgctcccc gcaacaactg       900
     cgggccgaca ccaacatcgt cgacagccag atggccctgc gccgcagcga acgcgccgac       960
     gaacacctca gcggtctgct cacggccacc gccatcatct ccggcaccgc cacggtctac      1020
     ctggcgctgc acggcaccct cgccgcgatc ctgctcgcgt ccctgctgac ggtgctggcg      1080
     ttcatgcggg cccgcatctt ccccaccgtc cgccagcgcc tccccttcct gctcgccgcc      1140
     acggcgggcc tggccggact cgccctctcc gcctgggtcc actggccccc cgagtaccgc      1200
     ttcgtcctcc tggtcgcggg cctcgtcgcc accgccgcca tagccctcgg ctatgtcctg      1260
     ggagtcgccg gaaaacccat cgcccccacc tggggtcgcc tggtcgacat cctcgaagtg      1320
     atcctgttcg tcgccgtcgt cccgctcacc ctgtgggtat gggacgccta ctggtgggtg      1380
     cgcaccgtca acggctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page