(data stored in SCRATCH zone)

EMBL: CP001778.PE404

CP001778.PE404       Location/Qualifiers
FT   CDS_pept        complement(418303..418890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0410"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ccs:CCNA_03223
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40127"
FT                   /db_xref="GOA:D3Q4G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD40127.1"
FT                   /translation="MPQASRGRRRQAELVAAGVEILSESGWEGLTHRAVAARAEANPGL
FT                   VHYYFKGSDGLRLAVAAQAARQSITALFDELLSVEPDAFPATLKRMLRAARDDRHAGRV
FT                   TTALISASFDDPAIGALVREEFADGRSRVEQWLHTRHPSWSPARTRGAAALLVATIDSL
FT                   ALQLLLDPELPLDDIDATTRTLWRAMETDGPT"
     gtgccgcaag cctcacgagg acggcgacgg caggccgaac tggtggccgc cggtgtcgag        60
     atcctgtccg aatccggctg ggagggcctc acccaccgcg ccgtcgccgc ccgcgccgag       120
     gccaaccccg gcctggtgca ctactacttc aagggatccg acggcctgcg gctcgccgtc       180
     gcggcccagg ccgcccggca gtcgatcacc gcgctgttcg acgaactcct gtcggtcgaa       240
     ccggacgcgt tccccgcgac actgaaacgc atgctgcgcg cggcacgcga cgaccggcac       300
     gcgggccggg tcaccaccgc cctgatcagc gccagcttcg acgatcccgc catcggcgcc       360
     ctggtgcgcg aggagttcgc cgacggccgc tcccgggtgg aacagtggct ccacacccga       420
     cacccgtcct ggtcaccggc ccggacgcgc ggggccgccg ccctgctcgt cgccacgatc       480
     gacagcctgg cactgcaact gctgctggac cccgaactcc ccctcgacga catcgacgcg       540
     accacgcgaa ccctgtggcg cgccatggaa acggacggcc cgacatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page