(data stored in SCRATCH zone)

EMBL: CP001778.PE406

CP001778.PE406       Location/Qualifiers
FT   CDS_pept        complement(420248..421885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0412"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   avi:Avi_2989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40129"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G9"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADD40129.1"
FT                   /translation="MVTFAQLQQSTTQSLLSGADAARKLARELEQFGAETDRLRRGLSA
FT                   GWSGDDATAAGTKLTEHVTGYRNAATSYGRIDQIVSTLVGEMNAAKQQLESAVSAAPSI
FT                   PGRVDGNGTVYVNWEALGPQPSAAAVATAKQNAMKVAGWIRDAVTRANTADQNAAGQLS
FT                   AVTGGAVPAPSTAGATVPAEGTDPAKVKEWWDGLSQQQREALIAADPKAVGGLDGVPIA
FT                   VRDQANRLALTSEMDSVGGQLSAAREELSKLSPGSPHDLASRQEYQEAASRVRELDQRW
FT                   DNLNSVKDQLGRTDLQGSTEKLHLIDYDSASDGKLVMSVGNPDTADNVLTFVPGMTTDV
FT                   EGIGTSMDYSLRMQADAAANLPGSSTASVMWLGYDAPDGVFGAANDNAYRAAAGDLTTF
FT                   QHGLRATHEGPASLNTLLGHSYGSSTVGYAASQADLRIDNLVFVASPGATVDSAGDFQG
FT                   IGADHVFATRGSDDIIRHVPEWFHGNDPVDADFGGRVFPGGDGGHSDYWNPGNPAREGI
FT                   ADIVTGQSNQLPITLQDPSVLRPESVRP"
     atggtcactt tcgcacaact tcaacagtcc accactcagt ccctgctcag cggcgccgac        60
     gccgcccgca aactggcccg cgaactggaa cagttcgggg ccgagaccga ccggctgcgc       120
     cgcggcctgt cggcaggctg gtccggcgac gacgccaccg ccgcgggcac caaactcacc       180
     gagcacgtca ccggctatcg caacgccgcg accagctacg gcaggatcga ccagatcgtg       240
     tccacactgg tcggcgagat gaacgccgcc aagcagcagc tggaatccgc cgtgtcggcg       300
     gccccgtcca tacccggccg ggtcgacggc aacggcaccg tatacgtcaa ctgggaggcg       360
     ctgggtccgc agccgtccgc cgccgcggtc gccaccgcca aacagaacgc gatgaaggtc       420
     gcgggctgga tccgcgacgc ggtcacgcgc gccaacaccg ccgaccagaa cgccgcgggc       480
     cagttgtcgg ccgtcaccgg cggtgccgtc ccggccccga gcaccgccgg tgccacggtt       540
     cccgccgagg gcaccgatcc ggcgaaggtc aaggagtggt gggacggcct gtcgcagcag       600
     cagcgcgagg cgctcatcgc ggccgacccc aaggcggtcg gtggcctgga cggcgtgccg       660
     atcgcggtgc gggaccaggc gaaccggctg gcgctgacct ccgagatgga cagtgtcggc       720
     gggcagctgt cggccgcccg cgaggaactg tcgaaactca gccccggcag cccgcacgac       780
     ctggcctcgc ggcaggagta ccaggaggcc gcctcccggg tacgcgagct ggaccagcgc       840
     tgggacaacc tcaacagcgt caaggaccaa ctgggccgca ccgacctgca gggctccacc       900
     gagaagctgc acctcatcga ctacgactcc gccagcgacg ggaaactggt gatgtcggtc       960
     ggcaaccccg acaccgccga caacgtcctc accttcgtgc ccggcatgac caccgacgtg      1020
     gagggcatcg gcaccagcat ggactactcg ctgcggatgc aggccgacgc ggcggccaac      1080
     ctgcccggat ccagcaccgc atcggtgatg tggctgggat acgacgcccc cgacggtgtc      1140
     ttcggcgccg ccaacgacaa cgcctaccgg gctgcggcgg gcgatctgac gacgttccag      1200
     catggactgc gcgccaccca tgaggggccg gcctcgctga acaccctgct gggccacagt      1260
     tacggctcct cgaccgtcgg ctacgcggcc agtcaggccg acctgaggat cgacaacctg      1320
     gtcttcgtcg ccagtccggg cgccaccgtc gacagcgcgg gcgacttcca gggcatcggc      1380
     gccgaccacg tcttcgccac ccggggttcg gacgacatca tccggcacgt cccggaatgg      1440
     ttccacggca acgatcccgt ggacgccgac ttcggcggcc gggtcttccc cggcggcgac      1500
     ggcggccact ccgactactg gaaccccggc aacccggccc gcgagggcat cgccgacatc      1560
     gtcaccgggc agtccaacca gctgccgatc acgctgcagg acccgtcggt gctgcggccc      1620
     gagtccgtcc ggccgtga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page