(data stored in SCRATCH zone)

EMBL: CP001778.PE408

CP001778.PE408       Location/Qualifiers
FT   CDS_pept        complement(423115..423387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpsf6; cleavage and polyadenylation specific
FT                   factor 6"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40131"
FT                   /db_xref="GOA:D3Q4H1"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40131.1"
FT                   /translation="MSAEVASTPLWIPVLLGGTLLLSLAAVVAVILLSVRVNKLSAELR
FT                   ARHPVQPMRPAPPPHGYGQQPQSPQPGQQPPLPPGQNPQQPPPPA"
     atgtcagctg aagtagccag caccccgctg tggattccgg tcctgctcgg cggcacgctg        60
     ctgctgtcgc tggcggccgt cgtcgcagtc atcctgctga gcgtgcgggt caacaaactg       120
     tccgctgagc tgcgcgcccg gcatcccgtc cagccgatgc gaccggcccc gccgccacac       180
     ggctacggcc aacagccgca gtcaccccag ccgggccagc aaccgccgct cccgcccggg       240
     cagaacccgc agcaaccccc gccaccggcc taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page