(data stored in SCRATCH zone)

EMBL: CP001778.PE422

CP001778.PE422       Location/Qualifiers
FT   CDS_pept        complement(435410..436258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0429"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   sew:SeSA_B0068 streptothricin acetyltransferase Sat-1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40145"
FT                   /db_xref="GOA:D3Q4I5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD40145.1"
FT                   /translation="MRIKANGVELCVETFGAPEDPPVLLIGVTMLSWPDELCQALAGRY
FT                   VVRYDLRDTGQSTFADPDAPGYDLRDLVSDASELLRALDLGPAHVVGMGVGGFIAQLLA
FT                   LDHPDRVASLTLISTRPVAPGPVDPDLPDHSPQMMQRLFGRAKPDWTDRDSVVDYMTGS
FT                   ARILSGTRGFDEQDARATAAAIFDRAEPTDKAQRASHLGIMFAAIDSKPRWRERLGEIK
FT                   APTLVVHGDEDPFFPHGNGVALAAEIPDASLLTLPGVGQGVPRAAWPTVVEALLRHTSG
FT                   T"
     atgcgaatca aggccaacgg ggtcgagctg tgcgtggaga ccttcggggc gccggaggat        60
     ccgccggtgc tgctgatcgg cgtcaccatg ctgagctggc cggacgagtt gtgccaggcg       120
     ctggccgggc ggtacgtggt gcgctacgac ctgcgcgaca ccggtcagtc gaccttcgcc       180
     gacccggacg cgcccggcta cgacctgcgc gacctggtga gtgacgcgtc cgagttgttg       240
     cgcgcgttgg accttggccc cgcccatgtg gtcgggatgg gcgtcggcgg cttcatcgcg       300
     caactgctcg cgctcgacca ccccgaccgg gtcgcgtccc tgacgctgat ctccacccgc       360
     ccggtcgcgc ccgggcccgt cgaccccgac ctgcccgacc actcgccgca gatgatgcag       420
     cgactgttcg gccgcgcgaa gccggattgg accgaccgcg acagcgtggt cgactacatg       480
     accggttccg cgcggatcct ttccggcaca aggggtttcg acgaacagga cgcgcgggcg       540
     accgccgcgg cgatcttcga ccgcgcggag ccgacggaca aggcccaacg cgccagccac       600
     ctcggcatca tgttcgcggc catcgacagc aaaccgcggt ggcgcgaacg gctcggcgag       660
     atcaaggccc cgaccctggt ggtgcacggg gacgaggatc cgttcttccc gcacggaaac       720
     ggggtggcgc tggccgccga gatcccggac gcctcgctgc tcaccctgcc cggcgtcggc       780
     cagggcgtgc cccgcgcggc ctggccgacc gtcgtcgagg ccctgctgcg ccacacctcg       840
     ggaacctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page