(data stored in SCRATCH zone)

EMBL: CP001778.PE431

CP001778.PE431       Location/Qualifiers
FT   CDS_pept        complement(444445..445101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0439"
FT                   /product="Hly-III family protein"
FT                   /note="PFAM: Hly-III family protein; KEGG: afw:Anae109_1200
FT                   hemolysin III family channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40154"
FT                   /db_xref="GOA:D3Q4J4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J4"
FT                   /inference="protein motif:PFAM:PF03006"
FT                   /protein_id="ADD40154.1"
FT                   /translation="MTAVINGPTKPRLRGLLHATAIPVAVIGAIVLVVIAPTIDGKIAS
FT                   AIYGLTSISLFGVSGFYHRSGNGYASEWLRRWDHANIYLIIAGTYTPFGVLALTGGAQL
FT                   AVLLIIWIGAAAGVAFRTVWLGAPRWLYTSLYIVLGWVAIFFIPQFLEGVGLAAVILVV
FT                   AGGLLYSLGAVVYGLKRPDPWPEVFGFHEIFHAFTVAAYLCQFSSVVLVVLASAP"
     atgactgcgg tgatcaacgg ccccaccaaa ccccggcttc gcgggctgct tcacgccacc        60
     gcgattccgg tggccgtgat cggcgccatc gtccttgtcg tcatcgcgcc aaccatcgac       120
     ggcaagatcg cctcggccat ctacggactc acgtcgatca gcctgttcgg cgtctccggt       180
     ttctaccacc gctccggcaa cggctacgcc tccgaatggc tgcggcgctg ggaccacgcg       240
     aacatctacc tcatcatcgc cggcacctac acgccgttcg gcgtcctggc gctcaccggc       300
     ggcgcccagc tggcggtgct gctgatcatc tggatcggcg cggcggccgg ggtggcgttc       360
     cggacggtgt ggctgggcgc gccgcgctgg ctgtacacct ctctctacat cgtgctgggc       420
     tgggtcgcga tcttcttcat cccgcagttc ctggagggcg tcggactggc ggcggtcatc       480
     ctcgtcgtgg ccggtggact gctgtacagc ctcggcgccg tcgtgtatgg actgaagcgg       540
     cccgacccgt ggccggaagt gttcggcttc cacgagatct tccacgcctt caccgtcgcg       600
     gcctacctgt gccagttctc gtcggtggtg ctggtggtcc tcgcctccgc cccctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page