(data stored in SCRATCH zone)

EMBL: CP001778.PE452

CP001778.PE452       Location/Qualifiers
FT   CDS_pept        complement(472009..477198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0460"
FT                   /product="putative signal transduction protein with Nacht
FT                   domain"
FT                   /note="KEGG: vsp:VS_II0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40175"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40175.1"
FT                   /translation="MSNVGIANSKDRVEALLWAAPTGPVPAPPVDTKSQVLPVRELDWS
FT                   DAERLFLRLLHTVQPVQFAKLFGVPGQSQAGIDAYARLPLDLTDSETNARDYITLQSRR
FT                   VEELTAAKVEKAIDDFVAGEWCSKTSVFYYATSFDLQHTKLDEVIRKQTSRLARMGITF
FT                   VPWGVQETSALLKDHPRIVYDFFGKPWVERFCGMEAARSLDEHLSLQDRRTLRSELRSL
FT                   YQAVFYSQGSGPSADQTEYAKRFIVLGVAPYRERSVVEQDGSQARDERLRPDQGLADGE
FT                   AYVESQPGIERQSFRSARHLLRSAIGNPTHPVDTVEADEWLTDGKYRLLVGRPGAGKSS
FT                   LLRFVATDLLSPQPQSIPLQREHAPDLPIWLPFGYLCRHLEASTENSVVSAMEAWLKAH
FT                   SADHLWPLVKHALRDDRLLLLVDGVDEWSNIGAAEQALGKLETFLGQTKASAILSTRPY
FT                   ALHRLNWRLPWGKAEITLLNDQQRLTIASQLLIPDTLEKSKSSNPLPWVGVEPFLAQLS
FT                   ATAELNDLSRTPLFLSLLATTWQGEPLPQQRFRIYDHLVELLVGKHPQMRRRASHADGG
FT                   PLPASEATTLFSAVAYRLRLKDPSGTVTKSEMRKLIVESMTDEDVLGYDLAEARRLAND
FT                   VLTTAEDEFGLIVSYGAGTYNFLHRTLLDHMAGQYLVTLPPHAQSEAVQQFVGDPAWRD
FT                   VLLALLSAQLSSHGTELLLAAALDAGERMWGDIEGYELLAEALAAGVKLTPKSQTRYIN
FT                   NLVERVETHPSLHHRANLIAALVGMLTNQLARKNLLPAMKRWLTAPRPNPAATMWALRE
FT                   LPIADECALKHLVWGLRHPEDRVKVNAALAIAQRFKGQTHLIDRLVSLAQTGPSSATQA
FT                   AVILALGTGWAEATETSGLIDWARSQPSVPLRLVALHLLQKSTTNGEAALFRPEERAWL
FT                   LSLLHYENWARGPWPADDLVDIAATGDVQVADFALETLTTNGRNGGDRRIAWTLACNEF
FT                   ADDSRFKQWTVAELAQPEERGLILYDPNIIPQQWIDDPEFTSILRSYLETKIGEPGAYS
FT                   VARLATALPPEDAKAVLLQGLNSWRPYSAARQLVEQYLDDEQVSTALIARLRGEYERAA
FT                   PLASIAVDVLGPKEGFGLQVSLLRQQDQTTSSEKRVVVALAVADAWKQFKDEARKVGVK
FT                   GQTARDLLASYDATELATLCTAVKPHPLMWHVPSVITAWPEQATVLEVADNLLYDERPI
FT                   TSGISDTIPVAILQAFCKRTDEPSQRIFNKGLDLLTHLEPELREVLAFELARSMLAAEE
FT                   HINVLSEWRTEPDTEVRRIAFIGLVQAIKNHQQHSETTTGADTPTSEMEWLRLEIKHDL
FT                   CAYGPQLEEHRQLAWIGMLMLGDLTLFDNIQESIGHSGQIPGVSLRLPYRDEKDQILVD
FT                   LVAENWVELCDHFGKDIFDRLISTSDRQRLTKRQRRRAVMSALVTVASRYPSIAEMIRG
FT                   DAGADVELRHDQNFLLWAKEENQGNVEVLRALVSKLGENAHRRQDPIVDSLLDRESWNV
FT                   SDEDFKAAFTEGASPRPFYSNNKLAIYTHMFPGDNISKAVFHELESWFQTEPSTRRYRD
FT                   LSEVLTLALSVASPQDLPAILLRAHARIHMGISDLFLPILTRPLTRRLQIDLEAVEAFK
FT                   SALAEPMAIHETSPILANADDPIIAADPDLQPLQRMYLFAIALKRAGALAQHEATAISH
FT                   LLASASPNTIVHNPFTNHEGPLCLAALDLISR"
     atgtccaatg ttggaattgc caacagcaaa gatcgcgtcg aagcgttgtt gtgggcagcc        60
     cctaccggcc cagtacctgc gccaccagtt gacaccaagt cgcaagtgtt gccagttaga       120
     gagctcgatt ggtctgatgc ggagcgcctg tttcttcggt tgttgcacac agtccaacct       180
     gttcaatttg ccaagctgtt cggggttcct ggtcagtctc aagccggtat tgatgcttac       240
     gcccgacttc cgttggactt gacggatagt gaaacaaacg ctcgcgacta catcactctg       300
     caatcacggc gagtggagga actcaccgcc gccaaggttg agaaggccat tgacgacttc       360
     gtcgctggag agtggtgcag taagacttcc gtcttctatt acgccacatc gttcgacttg       420
     cagcacacga aactcgacga ggtgattcgc aagcaaacaa gccgactggc gaggatgggg       480
     ataacgttcg ttccgtgggg ggtacaggaa acttctgcgt tgttgaagga tcatcctcgc       540
     attgtctatg actttttcgg taagccatgg gttgagcgat tttgcggcat ggaggcggcc       600
     cgatctctcg atgagcattt gtcgctccag gacaggcgaa ctctgcggtc agagttgagg       660
     agcctctatc aggccgtctt ttactcgcaa ggaagtggcc cttcagctga ccaaactgaa       720
     tacgccaagc ggttcattgt cctaggtgtt gccccctatc gcgaacgatc tgtagttgag       780
     caagacggat ctcaggcacg agacgagagg ctacgacctg accaaggttt ggcagatggg       840
     gaggcatatg ttgaatctca acccggcata gagcgtcaat ccttcaggtc agcacggcac       900
     ttgctacgaa gcgcaattgg caacccgaca cacccagtcg acaccgtcga agctgatgaa       960
     tggttgaccg acggaaaata caggttgctc gttggccgcc ccggagccgg taagtcaagc      1020
     ctcctgcgat tcgtcgcaac tgaccttctt tcacctcaac cgcaatcaat cccgctgcaa      1080
     cgcgagcatg cccccgattt gccaatctgg ttgccttttg gatacttgtg tcgccacctt      1140
     gaagcatcaa ctgagaactc ggtggtatca gcaatggaag cctggctgaa ggcccacagc      1200
     gccgatcacc tctggccatt ggtgaagcat gcccttcgcg acgatcgcct attgttgctc      1260
     gtggatggtg tggacgagtg gagcaatatc ggcgcagccg aacaggcact cggaaaactg      1320
     gagacgtttc tcggccagac caaagcctcg gcaatcctct ccacgcgtcc atacgcactc      1380
     cacaggctca actggcggtt gccatggggt aaagcagaga tcacgcttct gaacgaccaa      1440
     cagcgcctca ccatcgccag tcagctactg ataccagaca cattggagaa aagcaaatca      1500
     tccaatccac tgccgtgggt cggcgttgaa ccgttcctag ctcagctttc tgccacggcc      1560
     gaacttaacg acttgtcccg caccccactc ttcttgtcgt tgctggcaac gacgtggcag      1620
     ggcgagcctt tgccgcagca acggttcaga atctacgacc acctcgttga gcttttggtc      1680
     ggaaaacacc ctcaaatgcg acggcgtgct tcacatgcag acggagggcc cctgccagcg      1740
     agtgaggcca ccacattgtt ctctgcggtt gcctatcgac ttcgcctcaa agatccttcc      1800
     gggactgtca cgaagtcgga gatgcgcaaa ctgatcgtag agtcaatgac agacgaagat      1860
     gttctcggct acgacctagc ggaagctcgc aggttggcca acgacgtcct taccaccgcc      1920
     gaagatgagt tcggtttgat cgtctcatat ggtgctggca cgtacaattt cctacaccgg      1980
     actctgcttg accacatggc tggtcagtat ctcgtgacgc tacctcctca cgcacaatcc      2040
     gaggccgtac aacagtttgt cggtgatccg gcatggcgcg atgtactcct cgcactgttg      2100
     agcgctcaac tcagttcgca tggaacggag ttgcttctcg ctgcggcgct tgacgccgga      2160
     gagcggatgt ggggagatat cgaaggttac gagcttctcg ccgaggccct cgccgccggt      2220
     gtcaaactca cgccgaaatc ccaaacccga tacatcaaca acctggtaga acgggtcgaa      2280
     acccacccat cgctacatca tcgggcaaac ctcattgcgg ctctagtcgg catgcttacg      2340
     aatcaactcg cccgaaagaa cctgcttccg gccatgaaac ggtggcttac tgctcctcgc      2400
     cctaaccctg cagcaaccat gtgggcactg cgcgaactgc ccattgctga cgagtgcgcg      2460
     ctcaaacacc tggtatgggg cctgcggcat ccggaagacc gtgtgaaggt caacgcagcc      2520
     ttggccatcg cgcagcgctt caaaggtcag acacacttga ttgaccggct ggtatctctt      2580
     gcccaaaccg gaccatcctc ggcaacccag gccgctgtca tcctggctct cggcaccggt      2640
     tgggcagagg ctaccgaaac ttctggcttg attgactggg cccggagcca gccttcagtg      2700
     ccgctgcgcc tggtcgcatt gcatctactg caaaaatcca ccacgaacgg tgaagctgca      2760
     ctgtttcgcc cagaagaacg cgcctggctg ctgtccctcc tgcactacga gaattgggcc      2820
     cgcgggccgt ggcccgcaga tgaccttgtt gacatcgctg ccaccggaga cgtccaagtc      2880
     gccgatttcg cgctagaaac cctgaccaca aacggacgaa acggcggcga ccgccgtatt      2940
     gcgtggacgc ttgcctgtaa cgagttcgcc gacgatagcc gattcaaaca atggaccgta      3000
     gcggaactcg cccagccgga ggaacggggt cttatcctat atgaccccaa cataattccc      3060
     caacagtgga tcgacgatcc cgaatttacc tcaatacttc gctcgtacct agaaacgaaa      3120
     attggagaac ccggcgcata cagtgtcgcg agactcgcca ccgccttgcc gccggaagat      3180
     gccaaggcgg tactactgca agggctgaat tcttggcggc cgtactctgc agcgcgacaa      3240
     ctagttgaac agtacctaga tgacgagcag gtcagcacgg ctctgatcgc acgtcttcgc      3300
     ggcgagtacg aacgcgccgc gccattggca agcattgccg tcgacgtgct tggaccgaaa      3360
     gaagggttcg gtcttcaagt gtccctgctt cgccagcaag accaaactac gagttcggag      3420
     aagcgcgttg ttgtggcact ggcggtggcc gacgcatgga aacagtttaa agacgaagcc      3480
     cgaaaagtag gcgtcaaagg gcaaaccgca cgcgacttgc tagcaagcta tgacgcaacc      3540
     gagctagcga cgctgtgcac tgcggtgaaa cctcacccct tgatgtggca cgtcccctcc      3600
     gtaataaccg cctggccaga acaggcaaca gttctggaag tcgccgacaa cctcctatac      3660
     gatgaaagac ccattacatc aggtatatcc gacacaattc cagtcgcaat acttcaggcg      3720
     ttctgcaaaa gaaccgacga accctcccaa cgaatcttca acaagggact cgacctccta      3780
     acacatctgg aaccggagtt gcgcgaagta ttggccttcg aactagcacg cagcatgcta      3840
     gctgcagaag agcacatcaa cgtcctgtcg gagtggcgaa ccgagcccga caccgaagtt      3900
     cggcgcattg cctttatcgg cctcgttcaa gccatcaaga accaccagca gcacagtgaa      3960
     accacaactg gtgccgatac accgacctct gaaatggaat ggctgcgcct cgaaattaag      4020
     cacgaccttt gcgcctatgg accgcaactc gaagaacatc gacaacttgc atggatagga      4080
     atgctcatgc ttggagacct cacgctcttc gacaacatcc aggaatccat cggtcattcg      4140
     ggtcagatac caggggtgag tcttcgcctc ccctatcgtg atgaaaagga ccagatcctg      4200
     gtggatcttg tggcagagaa ctgggtagaa ctgtgcgatc atttcggcaa agacatcttc      4260
     gatcgactta tcagtacgtc tgatcggcaa cgtctaacta agcgccaacg acgccgagca      4320
     gtcatgtcag cgctcgtgac cgtcgcctcc agataccctt cgatcgcgga gatgatccga      4380
     ggtgacgccg gcgctgatgt tgaactacgc cacgatcaaa acttcttgct gtgggcgaag      4440
     gaagaaaacc agggcaacgt ggaggtactc cgcgccctag ttagcaaact tggcgaaaat      4500
     gcgcatcgac gacaagaccc aatcgtagac tcgttgctag acagagaaag ctggaatgtc      4560
     tccgatgagg acttcaaagc cgcatttact gaaggcgcga gtccacgccc cttctatagc      4620
     aacaacaagc tagccatata tacacatatg tttccgggag acaacatttc caaagctgtc      4680
     ttccacgagc ttgaatcgtg gttccaaacc gaaccttcga cacggaggta ccgcgatttg      4740
     tcggaggtac tgaccctcgc gctcagcgta gcttcaccac aggatttgcc cgccatcttg      4800
     ctccgcgccc acgctcgcat ccacatgggc atatccgacc tattcctacc aatcctgaca      4860
     cggccactga cacgccgcct gcaaatagac cttgaggcag tcgaagcctt caaatccgcg      4920
     ctcgctgagc cgatggccat ccacgaaacc agtccgatac tcgccaacgc cgacgatccg      4980
     atcatcgccg cagatccaga tctgcaaccg ctacaacgca tgtacctctt tgccatcgcc      5040
     ttgaagcggg ctggggctct cgcacagcac gaagcgacag caatcagcca tctattggcg      5100
     tccgcttcac ctaacaccat cgtgcacaac cccttcacca accatgaagg acctctttgt      5160
     ctcgccgcac tggacctcat ctcacgctga                                       5190
//

If you have problems or comments...

PBIL Back to PBIL home page