(data stored in SCRATCH zone)

EMBL: CP001778.PE458

CP001778.PE458       Location/Qualifiers
FT   CDS_pept        483532..486618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0466"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; transcriptional regulator domain
FT                   protein; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40181"
FT                   /db_xref="GOA:D3Q4M1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M1"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD40181.1"
FT                   /translation="MAVLGPVRVCVGGVPVEVSAGRVRLLLARLALARGRVVTAEVLIE
FT                   ELWGGERLSDAVNTLQALVSRLRKVVGASAVELVGGGYRLAAAVDAERFEELAARGRRE
FT                   LGAGEVAAALVSVDAALGLWRGPALGDLADVGFVRAAAGRLAEARLRAVEDRFEAALRL
FT                   GRHGDVLGELAGAVAEHPVRERLAALRIRALYEVGQQSEALAAYERVRAELGERFGVDP
FT                   GAELRRVHVAMLRGELEPLLERPKPVPGRLPAQLTSFGGRDAELATLAGALAEARLVTV
FT                   VGPGGVGKTRLAVEAAGRLDAHERGRVWFVPLAGAAGDVGGAVLGVLGAERVRPGGGKG
FT                   LDQLVELIGPEAAVLVLDNCEHVVADAADFAGALLERLPLLTILATSREPLAITGEALC
FT                   RLEPLGLPSGVAMAAESAAVRLFVERARAVRPGFALDETTAGPVVDICRRLDGLPLALE
FT                   LAAARLRAMPLTEIVSRLDDRFRLLASGSRTALPRHRTLAGVVEWSWELLTGPEQLLAA
FT                   RLSIFPGGATVAALEEVASDETVPVGEVVYVLGSLVEKSLVHWDGQRYRMLETIRSFAG
FT                   ERLDDAEGFGARFTRYFAAVAEEQEPRLRLAEQLDALRWFDTEYDNLVAALRAAIDGRV
FT                   ADVAARLVGAVQWYWHTMRFDARSDGFVAEVLDFGEALPDHSRAALALSWMLTDDTSAA
FT                   DPERLRSAIEDCVSTGALERYPTLLFLTAPMAYFMGQVELAERLLRGAEERSQPWSAGI
FT                   AAWARSVFRADQGDWAGAAALRLRALRQYETAGDRVGLAFILGRVAQDHALRGEHDEAI
FT                   AALQRCVVLAAEISSAEEISYRSRLGAQRSRAGDADGARRELDVALRQAIERGQPQLRI
FT                   EPLVGLADLHRRAGEADRADALLAELETLVRGLAGAEQTAAAVIAPVRMALRLDTGDAK
FT                   AAETLPVVAATGTLARDLAAPAAELLARLRFRDGDPEGAAVALGMSQVIRGVLDRGDPE
FT                   LRALTDALVARLGADGYAAAFQRGAELPRDEALRRVGTF"
     gtggcggtgc tggggcccgt gcgggtctgc gtcggcgggg tgccggtcga ggtctcggcc        60
     gggcgggtgc ggttgctgct ggcgcggttg gcactggccc gggggcgggt ggtgaccgct       120
     gaggtgctga tcgaggagct gtggggcggg gagcggctct cagacgctgt gaataccttg       180
     caggcgttgg tttcgcggtt gcgcaaggtg gtgggggcct cggcggtgga gctggtgggt       240
     ggcgggtatc ggttggcggc ggcggtggac gcggagcggt tcgaggagtt ggccgcgcgg       300
     gggcggcggg agttgggggc aggggaggtc gcggcggctt tggtgagtgt ggacgcggcc       360
     ttggggttgt ggcgtggccc ggcgttgggg gatttggcgg atgtggggtt cgtgcgggcg       420
     gcggcggggc ggttggcgga ggcgcggctg cgggccgtgg aggatcggtt cgaggccgcg       480
     ttgcggttgg ggcggcacgg ggacgtgttg ggagagctgg cgggcgcggt agcggagcac       540
     ccggtgcggg agcggttggc ggcgttgcgg atccgggcgc tgtacgaggt ggggcagcag       600
     tcggaggcct tggccgcgta cgagcgggtg cgggcggagt tgggggagcg gttcggggtg       660
     gatcccgggg ccgagttgcg gcgggtgcac gtggcgatgt tgcgcggcga gctggaaccg       720
     ttgctggagc ggccgaagcc ggtgccgggg cggttgcccg cgcagctgac gagtttcggg       780
     ggccgggacg cggagttggc gacgttggcg ggggcgctgg ccgaggctcg gctggtgacg       840
     gtggtggggc ccggcggtgt gggcaagacg cggttggcgg tcgaggcggc gggacggctc       900
     gacgcgcacg agcgggggcg ggtgtggttc gtgccgttgg ccggggcggc gggggacgtc       960
     ggtggcgcgg tgctgggggt gctgggtgcc gagcgggtgc ggccgggcgg gggcaagggg      1020
     ctggatcagc tcgtggagtt gattggtccc gaggcggcgg tgctggtgct ggacaactgc      1080
     gagcatgtgg tggccgatgc cgccgacttc gccggggcgc tgctggaacg gttgccgctg      1140
     ttgacgatcc tggccaccag ccgggagccg ctggcgatca cgggggaagc gttgtgccgc      1200
     ttggagccgc tgggcttgcc cagcggggtc gcgatggcgg cggagtcggc ggcggtgcgg      1260
     ttgttcgtgg aacgggcgcg ggcggtgcgg ccggggttcg cgttggacga gacgacggcg      1320
     ggaccggtcg tcgacatctg ccgcaggctg gacggactgc cgttggcgct ggagctggcg      1380
     gcggctcggt tgcgggcgat gcccctcacc gagatcgtga gtcggctgga cgaccggttc      1440
     cggctgctcg cgtcgggaag ccggacagcg ttgccacggc atcggacgct ggccggggtg      1500
     gtggagtgga gctgggagtt gctgaccggg ccggagcagc tgctggccgc gcggttgtcg      1560
     atctttccgg gcggcgcgac ggtcgccgcg ctcgaggagg tggcctccga cgagacggtg      1620
     ccggtcgggg aggtcgtcta tgttctcggg tcgctggtgg agaagtcgct ggtgcactgg      1680
     gacgggcagc ggtaccggat gctggagacg attcgctcgt tcgcgggcga gcggctggat      1740
     gacgccgagg gcttcggtgc ccggttcacg cggtacttcg cggcggtggc cgaggagcag      1800
     gagccccggt tgcggttggc cgaacagctc gacgcgttgc gctggttcga caccgagtac      1860
     gacaacctgg tggcggcgct gcgagcggcc atcgacggac gtgtcgcgga cgtggcggcg      1920
     cggctggtcg gggcggtgca gtggtactgg cacaccatgc gtttcgacgc caggtcggac      1980
     gggttcgtcg ccgaggtgct cgacttcggg gaggcgcttc ccgatcacag ccgggcggcg      2040
     ctggccctgt catggatgct caccgacgac acgtcggccg ccgatcccga gcggctgcga      2100
     tcggctattg aggactgtgt gagtaccggt gcgctggaac ggtatccgac gttgctgttc      2160
     ctgacggcac cgatggccta cttcatgggg caggtcgagc tggccgagcg gctgctgcgc      2220
     ggcgccgagg aacgttcgca gccgtggtcg gcgggcatcg cggcctgggc gcggtcggtg      2280
     ttccgcgccg accagggcga ctgggcgggc gcggcggcac tgcggctgcg ggcgttgcgc      2340
     cagtacgaga ctgcgggcga ccgggtcggg ctggcgttca tcctcggcag ggtcgcgcag      2400
     gaccacgcac tgcggggcga gcacgacgag gcgatcgcgg ctcttcagcg gtgtgtggtg      2460
     ctggcggccg agatcagttc ggcggaggag atctcgtacc ggtcccggct gggcgcgcag      2520
     cggtcgcggg ccggggacgc cgacggggcc cggcgggagc tggacgtcgc gctgcggcag      2580
     gcgatcgagc gcgggcagcc gcagctgcgg atcgagccgc tggtgggcct ggccgacctg      2640
     caccgccgcg cgggggaggc ggatcgcgcc gatgcgctgc tcgccgagct ggagacgctg      2700
     gtgcggggcc tggccggggc cgagcagacc gccgcagccg tcatcgcgcc ggtccggatg      2760
     gcactccggc tcgacaccgg tgacgcgaag gcggcggaga cactgcccgt ggtggccgcg      2820
     accggaaccc tcgcccggga cctggcggcc ccagccgccg aactgttggc ccggctgcgt      2880
     ttccgggacg gcgacccgga gggggccgcg gtcgcactgg ggatgagcca ggtcatccgc      2940
     ggcgtcctgg atcgcggcga cccggagttg cgggcactga cggacgcact cgtcgcacgg      3000
     ctcggcgccg acggctacgc ggcggcgttc caacggggcg cggagctgcc acgggacgag      3060
     gcgctgcgcc gcgtcggcac gttctga                                          3087
//

If you have problems or comments...

PBIL Back to PBIL home page