(data stored in SCRATCH zone)

EMBL: CP001778.PE470

CP001778.PE470       Location/Qualifiers
FT   CDS_pept        499203..499637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40193"
FT                   /db_xref="GOA:D3Q5P4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40193.1"
FT                   /translation="MSELWTAVAALAAVAAVVTPVLMVLRTRMREAKRPAYEKACENFD
FT                   QLDRMSAAVTRRSFTRSELDDESFDDLLGDLEVVERKTFDGWRTRNAAPVRELISHAKA
FT                   MYHAESADDPDWKLKQGVEAGAIQKTLRRARAALYHQWGR"
     atgtcagaac tgtggactgc cgtggcggcg ctggccgccg tggcagccgt ggtcaccccg        60
     gtgctgatgg tccttcgcac ccgcatgcgg gaggcgaagc gtccggccta tgagaaggcc       120
     tgcgagaact tcgaccagct ggaccggatg tcggccgccg tcaccagacg gtcgttcacc       180
     aggtccgaac tggacgacga gagtttcgac gacctgctcg gcgacctgga agtcgtcgag       240
     cgcaagacct tcgacggctg gcggacgcgc aacgccgccc cggtgcggga actgatctcc       300
     cacgccaagg ccatgtacca cgccgaatcc gccgacgatc cggactggaa actcaagcag       360
     ggcgtcgagg ccggagcgat ccagaagacc ctgcgccgcg ctcgcgcggc tctctaccac       420
     caatggggac gctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page