(data stored in SCRATCH zone)

EMBL: CP001778.PE473

CP001778.PE473       Location/Qualifiers
FT   CDS_pept        complement(501555..502415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGP9; AGP9 (ARABINOGALACTAN PROTEIN 9)"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40196"
FT                   /db_xref="GOA:D3Q5P7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40196.1"
FT                   /translation="MERIIIAASAIAVAGLVLTALSATALGSAKAAAKWPSAERPRMGA
FT                   APARIGVVLGVLLCATAAGVGVSLVPVTKLWVLVPLIAAAGLITLGLTAWAAVKLASKI
FT                   ELSALINAPSPLGGEVQTATRSARTQPPTIQGPPTQVSPEQISYGKPYPGMVTVASPPG
FT                   SPPALDLSAADGVHTTTPDSSPPATQSPVSAPAVDPADVTIPPEALPGWVYTDEADNWY
FT                   LVTSVPEGHRLLRLSDFSVVPPGAAAGALNLAGSIEMTVWPANPDDTDTQEHPVVVEEE
FT                   PPPAN"
     atggagcgca tcatcatcgc cgcttcggcc atcgccgtgg cggggttggt gttgaccgcc        60
     ctgtcggcca cggcgttggg ttcggccaag gccgccgcga agtggccttc ggcggaacgg       120
     ccccggatgg gtgccgcgcc cgcgcgcatc ggcgtcgtcc tcggggtgct gctgtgcgcc       180
     acggcggccg gggtgggggt gtccctggtg ccggtgacga agctgtgggt cctggtgccg       240
     ctgatcgccg cggcggggct catcacgctg gggctgactg cttgggcggc tgtcaaactc       300
     gccagcaaaa tcgaactatc agcactcata aatgcgccgt cccccctggg tggagaggtt       360
     cagactgcca cgcgatcggc gcggacgcaa ccacccacga tccaggggcc acccacacag       420
     gtgagcccgg agcagatctc gtacggcaag ccgtatccag gcatggtgac cgtcgcgtcg       480
     ccacccggct cacctcctgc tctcgacttg tcggcggctg atggggttca tactacgacg       540
     cccgacagct cgccccccgc aacgcaatcc cccgtttcgg caccggccgt cgacccggcc       600
     gacgtgacga tcccgccgga agccttgccc ggctgggttt acaccgacga ggccgacaac       660
     tggtacctgg tgacctcggt tccggagggg catcggctgc tgcggctcag cgatttctcg       720
     gtcgtgccgc cgggcgcggc ggccggggcg ctgaacctgg cgggcagcat cgagatgacc       780
     gtgtggcccg ccaatcccga cgacaccgac acccaggagc acccggtggt cgtggaagag       840
     gaaccgccgc ccgccaactg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page