(data stored in SCRATCH zone)

EMBL: CP001778.PE480

CP001778.PE480       Location/Qualifiers
FT   CDS_pept        complement(511298..511837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40203"
FT                   /db_xref="GOA:D3Q5Q4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40203.1"
FT                   /translation="MSVQQPRTRQAEGEADSYPDPKRSWGRSGSLLGTWGVLLVAVYLA
FT                   GWMFDGLVDKSPESNLDKPVEDANQTARRVLQFSLVHREPTKADPLLCDGFTGLTPKQL
FT                   TKELTDWEASEGVLSEATVTFENVNGEAVDGGTLFPMRVELEVDPSFIVWNYDVTVKPD
FT                   GDSFCVSKVENVTSDD"
     atgagcgtgc agcaaccccg gacgcggcaa gcggagggcg aggcggactc gtaccccgac        60
     ccgaaacgct cgtggggacg gtcggggagc ttgctgggga cttggggggt gctgctggtc       120
     gcggtttatc tcgcggggtg gatgttcgat gggttggtgg acaagtcgcc ggagagcaat       180
     ttggacaaac ctgtcgagga cgccaaccag accgcgcgcc gagtactcca gttctcgctg       240
     gtgcaccggg aaccgactaa ggccgatccg ctgttgtgcg acggtttcac cggcctgaca       300
     ccgaaacagc tcaccaagga gctcaccgat tgggaggcct cggagggcgt cttgtccgaa       360
     gccaccgtga ccttcgagaa cgtgaatggt gaagccgtcg acggcggcac actgtttccc       420
     atgcgggtgg agctcgaggt cgacccttcg ttcattgtct ggaactacga cgtcacggtc       480
     aaacccgacg gagacagctt ttgtgtctcc aaagtcgaga acgtgacgtc cgacgactaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page