(data stored in SCRATCH zone)

EMBL: CP001778.PE491

CP001778.PE491       Location/Qualifiers
FT   CDS_pept        complement(523834..526179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0499"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mno:Mnod_7542 V-type H(+)-translocating
FT                   pyrophosphatase; TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40214"
FT                   /db_xref="GOA:D3Q5R5"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R5"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADD40214.1"
FT                   /translation="MSQSLLADGQGDAVGVNLTYVILAAVLALIALGFAAALVKMVLAT
FT                   GKGTKKMQEIAGAVQEGASAYLKRQFRTLAIFVVIAMVLLWFLPVHDVGDSETMVKAGR
FT                   SAFFVVGAGFSAFIGWAGMGLATRANLRVASAARDGSRTGAMAIAFRTGGVVGFLTVGL
FT                   GLLGAAVVVMVFKGNAATVLEGFGFGAAMLAMFMRVGGGIFTKAADVGADLVGKVEQGI
FT                   PEDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGQIAFGDTGLVLPLII
FT                   GAVGIVTAIFGVFITKLRASDKNGLTAINRAFFISAVLAAVLSAGAILATVPNTWAALG
FT                   VEEAVHKGVPFSPQVTAIVAVVIGIVLAAAIMALTGYYTETEKRPVSDVAKTSLTGPAT
FT                   VILSGVSLGFESAVFSALVIGAGVYGAFLLGGATAMFVSLFAIALAGCGLLTTVGVIVA
FT                   MDTFGPISDNAQGIAEMSGDIDEEAARTLTDLDAVGNTTKAITKGIAIATAVLAATALF
FT                   GSYTSAINVALAEGGKLADGGIDVLLNIANPANIVGVIVGAAVVFLFSGLAVNAVSRSA
FT                   GAVVFEVRRQFREFPGIMDGTQRPEYGRVVDICTRDAQRELMTPGLLAILAPIAVGFGL
FT                   GAGALAAYLAGAIACGVLMAIFLANSGGAWDNAKKAVEDGAHGGKGSEAHDATVIGDTV
FT                   GDPFKDTAGPAINPLIKVMNLVSLLIAPAVIMFSSYGENPNPAVRISIAVVALLIIVAA
FT                   VGWSRSKPITVGEDKPSDNGADKEKVDA"
     atgtctcaat cgttgcttgc cgatgggcaa ggcgatgcgg ttggcgtcaa cctgacgtac        60
     gtcatcctcg cggccgtatt ggcgctgatc gcgctcggct tcgccgccgc attggtcaag       120
     atggtgcttg ccaccggcaa gggcaccaag aaaatgcagg agatcgccgg tgccgtccag       180
     gaaggagctt cggcctacct gaagcgccag ttccggacgc tcgcgatctt cgtcgtcatc       240
     gccatggtgc tgctgtggtt cctgccggta cacgatgtcg gtgactccga gaccatggtg       300
     aaggcgggcc gcagcgcctt cttcgtcgtg ggcgccgggt tcagtgcctt catcggctgg       360
     gccgggatgg gtcttgccac ccgcgccaac ctgcgggtcg cctcggccgc ccgcgacggc       420
     agccgtaccg gggccatggc catcgcgttc cgcaccggtg gcgtcgtcgg cttcctgacc       480
     gtcggtctgg gcctcttggg cgcggccgtg gtcgtcatgg tcttcaaggg caacgcggcc       540
     accgtgctgg aaggcttcgg cttcggtgcc gccatgctgg ccatgttcat gcgggtcggc       600
     ggcggcatct tcaccaaggc cgccgacgtc ggcgccgacc tggtcggcaa ggtcgagcag       660
     ggcatccccg aggacgaccc ccgcaacgcc gccaccatcg ccgacaacgt cggtgacaac       720
     gtcggcgact gcgccggcat ggccgccgac ctgttcgagt cctacgccgt caccctggtg       780
     gcctcgctga tcctgggcca gatcgccttc ggcgacaccg gcctggtgct gccgctgatc       840
     atcggtgccg tcggcatcgt caccgcgatc ttcggtgtct tcatcaccaa gctgcgcgcc       900
     tcggacaaga acggcctgac cgcgatcaac cgggccttct tcatctcggc ggtgctggcc       960
     gccgtgctga gcgccggggc gatcctggcg accgtcccca acacctgggc cgcgctgggc      1020
     gtcgaggaag ccgtccacaa gggcgttccg ttctcgccgc aggtcaccgc gatcgtcgcc      1080
     gtggtcatcg gtatcgtcct ggccgccgcc atcatggcgc tgaccggcta ctacaccgag      1140
     accgagaagc gtccggtctc cgacgtcgcc aagacctcgc tgaccggacc ggccaccgtc      1200
     atcctgtcgg gtgtctcgct gggcttcgag tcggcggtgt tctcggcgct ggtcatcggc      1260
     gcgggtgtgt acggcgcctt cctgctgggt ggcgccaccg cgatgttcgt gtcgctgttc      1320
     gccatcgcgc tggccggttg cggtctgctg accacggtcg gcgtcatcgt cgccatggac      1380
     accttcgggc ccatcagcga caacgcgcag ggcatcgccg agatgtccgg tgacatcgac      1440
     gaggaggccg cgcgcaccct caccgacctg gacgccgtcg gcaacaccac caaggccatc      1500
     accaagggca tcgcgatcgc gaccgccgtg ctggcggcca ccgcgctgtt cggctcctac      1560
     accagtgcca tcaacgtcgc gctggccgag ggcggcaagc tcgccgacgg tggtatcgac      1620
     gtgctgctca acatcgccaa cccggccaac atcgtcggcg tcatcgtcgg cgcggccgtg      1680
     gtgttcctgt tctcgggtct ggccgtcaac gcggtgtcgc gttcggccgg tgccgtggtc      1740
     ttcgaggtgc gccgccagtt ccgggagttc ccgggcatca tggacggcac ccagcgcccc      1800
     gagtacggcc gggtcgtgga catctgcacc cgcgacgcgc agcgcgagct catgacgccg      1860
     ggtctgctgg cgatcctggc gccgatcgcg gtcggtttcg gcctgggcgc gggcgcgctg      1920
     gcggcctacc tggccggtgc catcgcctgc ggcgtgctca tggcgatctt cctggccaac      1980
     tccggtggtg cctgggacaa cgccaagaag gccgtcgagg acggcgctca cggcggcaag      2040
     ggctccgagg cccacgacgc caccgtcatc ggtgacaccg tcggcgaccc gttcaaggac      2100
     accgccggtc cggcgatcaa cccgctgatc aaggtcatga acttggtctc gctgctgatc      2160
     gcccccgccg tgatcatgtt ctcgtcctac ggcgagaacc cgaacccggc ggtgcggatc      2220
     tcgatcgccg tggtcgcgct gctgatcatc gtcgccgccg tcggctggag ccgctccaag      2280
     ccgatcaccg tcggcgagga caagccgtcc gacaacggcg ccgacaagga aaaggtcgac      2340
     gcctga                                                                 2346
//

If you have problems or comments...

PBIL Back to PBIL home page