(data stored in SCRATCH zone)

EMBL: CP001778.PE512

CP001778.PE512       Location/Qualifiers
FT   CDS_pept        546012..546569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0520"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rpd:RPD_4377 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40235"
FT                   /db_xref="GOA:D3Q5T6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD40235.1"
FT                   /translation="MDEATPSTGLSASMSADEQLIHALHAEHADALWRYACRLTGGDEA
FT                   RAQDAVQETLLRAWRNSRVLASSPDHARRWLYRTLRSRVIDEWRYRKNRPEVITDTLPE
FT                   RHAADHVDSALQGLLVVEALRKLSPAHREVLMECFYGGRSVNEAAEKLAIPAGTVKSRL
FT                   HYALRALKLALEEAGVVRREER"
     atggacgaag ccacaccgag caccggcttg agtgcttcca tgtcggccga cgagcagctg        60
     atccacgcgc tgcacgccga gcacgccgac gcgctgtggc ggtacgcgtg ccgcctgacc       120
     ggtggcgacg aggcgcgggc gcaggacgcg gtgcaggaga cgctgctgcg ggcctggcgg       180
     aactcgcggg tgctggcgtc ctcgccggac cacgcgcggc gctggctgta ccgcacgctg       240
     cgcagccggg tcatcgacga gtggcggtac cgcaagaacc gcccggaggt gatcacggac       300
     acgctgccgg aacggcacgc cgccgatcac gtcgactcgg cgttgcaggg cctgctcgtg       360
     gtggaggcgc tgcgcaaact cagcccggcc caccgggagg tgctgatgga gtgcttctac       420
     ggtggacgaa gtgtgaacga ggcggcggag aaactggcga taccggccgg aaccgtcaaa       480
     tcgcggctcc attacgcgct gcgggcgctg aagttggcgc tggaggaagc cggagtggtc       540
     aggagggagg aacgatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page