(data stored in SCRATCH zone)

EMBL: CP001778.PE521

CP001778.PE521       Location/Qualifiers
FT   CDS_pept        552930..553898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0529"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   scl:sce5141 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40244"
FT                   /db_xref="GOA:D3Q5U5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U5"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ADD40244.1"
FT                   /translation="MNDPTQQFEPHRRELTGYCYRMLGSAFEAEDAVQETMVRAWKNFD
FT                   RFEGRSSVRSWLYRIAGNVCFDMLRSPQRRARPSDLTGPSTADDMPGPPLSESTWIGPI
FT                   PDSLVAADPADRAVTKDSVKLAFIAALQKLPAKQRAVLVLREVLDWSAAETAELLELSV
FT                   ASVNSALQRARATVADLDEGVTDDRDPLDKDQQELLDNYVSAFEAYDLDALTHLLHEDA
FT                   TLSMPPLDLWLRGADQIRAWFLGTGCGCRGSKLVPVAANGVPTFAQYRPSEDPEVWKPW
FT                   ALILLDIRDGQIVAQNNFLDVERLFPLFGLAMEYRLPKATA"
     atgaacgacc cgacccagca gttcgagccg catcggcgtg aactcaccgg ttactgctat        60
     cgcatgctcg gttcggcctt cgaagccgag gacgccgtgc aggagaccat ggtccgggcc       120
     tggaagaact tcgaccgctt cgagggccgc tcctcggtgc gttcctggct gtaccgcatc       180
     gcgggcaacg tctgcttcga catgctgcgc agcccgcagc gtcgggcccg gccctcggac       240
     ctgaccgggc cgagcaccgc cgacgacatg ccgggaccgc cgctgtcgga gtcgacctgg       300
     atcggcccga tccccgacag cctggtcgcc gccgacccgg ccgaccgcgc cgtcaccaag       360
     gactcggtga agctggcctt catcgcggcg ctgcagaaac tgcccgccaa acagcgcgcc       420
     gtcctggtgc tgcgcgaggt gctggactgg tcggccgccg agaccgccga actgctggaa       480
     ctgagcgtcg cctcggtcaa cagcgcgctg caacgggccc gcgccaccgt cgccgacctg       540
     gacgagggcg tcaccgacga ccgcgacccg ctcgacaagg accagcagga actgctcgac       600
     aactacgtgt cggccttcga ggcctacgac ctggacgcgc tgacgcatct gctgcacgag       660
     gacgcgaccc tgtcgatgcc gccgctggac ctgtggctgc gcggtgccga ccagatccgg       720
     gcctggttcc tcggcaccgg ctgcggctgc cgcggttcca aactggtgcc cgtggccgcc       780
     aacggtgtcc ccacgttcgc ccagtaccgg cccagcgagg accccgaggt gtggaagccg       840
     tgggcgctca tcctgctgga catccgggac ggccagatcg tggcgcagaa caacttcctg       900
     gacgtggagc ggctgttccc gctgttcggc ctggccatgg agtaccggct gccgaaggcc       960
     accgcctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page