(data stored in SCRATCH zone)

EMBL: CP001778.PE530

CP001778.PE530       Location/Qualifiers
FT   CDS_pept        complement(569318..571264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_2405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40253"
FT                   /db_xref="GOA:D3Q5V4"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40253.1"
FT                   /translation="MTEPKHHRAQTLVIVVAALVAASVAIVLASLGGTRDLYVSTSGDD
FT                   SWDGSLERPFASLKRAQKEVRALTDSMGADITVHVRGGTYRLSQPLKFNGEADSGRNGH
FT                   RVVYQAYGYGTSEPERVTISGGHKVSGWNTDDGVWSAKVGDLRTRQLYVDGDRAPRAGL
FT                   GGGIPGDAIATKTGYTTDSTAPQSWKDPENIEFVYTLALYTDRRCGVKDVTGDESGSTI
FT                   TMDSECWGLMLAEADDPVLGEKGELPSEPTDIVNSRSFLDKAGSWFLDRTGSGEHTLFY
FT                   KPLPGQEPGSTEVVAPRLETLVDGSGGSGKRLHDVDLNGFTFAEATWLAPDEPSGFVSS
FT                   WSSYSLPGEQARRTVPGNVRFRDSDRIGLRGNTFTRLGGQGLEISSSSSGFVVAGNEFT
FT                   DISDGGIVMGLLPPDTAGEHRDNRIADNWVHDIGVENRAASGIWLMGTKDATIEHNQVN
FT                   DVPHMGILAGRDPDVPAATSGTRILGNLVIDAMQRIGDGGGIYLRGSQGDSYADGALVK
FT                   GNVVTNARTDTGGFFNIGIYTDDGSKWVTVADNATYDNLAAIGGCDESPRRPVDRIRFT
FT                   GNFWDDAVPEGIDRMDFPGAWPCGQPHHVSFAGNTTLSQTAPARACRSNLDCVTILKRA
FT                   GLSDEYRELLRDK"
     atgaccgaac cgaagcacca ccgcgcccag acgctcgtga tcgtggtcgc ggcacttgtc        60
     gccgccagtg tggccatcgt gttggcgtcg ctgggcggca cgcgggacct ctacgtgtcg       120
     acgtccggcg acgactcctg ggacggcagc ctggagcggc cgttcgcgtc cctgaagcgc       180
     gcccagaagg aggttcgcgc gttgaccgac tcgatgggcg ccgacatcac cgtccacgtc       240
     cggggcggaa cctaccggct gtcacagccg ctgaagttca acggggaggc cgattccggt       300
     cgcaacgggc atcgagtggt ctaccaggcc tacggctacg ggacgtccga acctgagcgg       360
     gtcacgatca gcggtggcca caaggtcagc ggctggaaca ccgacgacgg cgtgtggagc       420
     gcgaaggtcg gcgacctgcg gacccggcag ctgtacgtcg acggcgatcg cgcgccccgg       480
     gccgggctcg gcggcgggat tcccggtgac gctatagcca ccaaaaccgg ttacaccacc       540
     gacagcaccg cgccacagtc ctggaaggac ccggagaaca tcgagttcgt gtacacgctg       600
     gcgctgtaca ccgatcgccg ttgcggcgtc aaggatgtca ccggcgatga gtccggttcg       660
     acgatcacca tggactccga gtgctggggg ctgatgctgg ccgaggccga cgacccggtg       720
     ctcggcgaga agggcgaact gccctccgaa ccgaccgaca tcgtcaactc gcgaagcttc       780
     ctcgacaagg cgggttcgtg gttcctcgac cgcaccggtt ccggggaaca cacgctgttc       840
     tataagccgc tgccgggaca ggaaccgggg agcaccgagg tcgtcgcgcc gcgattggag       900
     acccttgtag atggttcagg cgggtccggg aagcggctgc acgacgtcga tctcaacggc       960
     ttcaccttcg ccgaggccac ctggctggct ccggacgaac cgagcgggtt cgtcagttcg      1020
     tggagttcct attcgctgcc cggcgagcag gcccgccgta ccgtccccgg caatgtgagg      1080
     ttccgcgaca gtgatcggat tggcttgcgc ggcaacactt tcactcggct cggcggccag      1140
     ggtcttgaga tctcgtccag cagttccggt ttcgtggtgg cgggcaacga gttcaccgac      1200
     atctccgacg gcggcatcgt catggggctg ctgccgcccg acacggccgg ggaacatcgc      1260
     gacaaccgga tcgccgacaa ctgggtgcac gacatcgggg tggagaaccg agccgcctcg      1320
     gggatctggc tcatgggcac caaggacgcc accattgagc acaaccaggt caacgacgtc      1380
     ccgcacatgg gcatcctcgc cggacgcgac ccggacgtgc ccgccgcgac cagcggcacc      1440
     cggatcctcg gcaacctggt gatcgacgcg atgcagcgga tcggggacgg tggcggcatc      1500
     tacctgcgcg gcagccaggg tgactcctat gccgacggtg cgctggtgaa gggcaatgtg      1560
     gtcaccaacg cgcgcaccga caccgggggt ttcttcaaca tcgggatcta caccgacgat      1620
     ggctcgaagt gggtcacggt ggcggacaac gccacctacg acaacctggc ggcgatcggc      1680
     ggttgcgacg agtcgccgcg gcgtccggtg gaccggatcc gcttcaccgg gaacttctgg      1740
     gacgacgcgg ttcccgaggg catcgaccgg atggacttcc cgggtgcgtg gccgtgcggg      1800
     cagccgcacc acgtctcctt cgcgggcaac accacgctgt cacagaccgc cccggcgcgg      1860
     gcgtgtcggt ccaatctgga ttgcgtcacg atactcaagc gagctggcct ttcggacgaa      1920
     taccgggaac tgttgcggga caagtga                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page