(data stored in SCRATCH zone)

EMBL: CP001778.PE535

CP001778.PE535       Location/Qualifiers
FT   CDS_pept        complement(574824..575585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0544"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40258"
FT                   /db_xref="GOA:D3Q5V9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADD40258.1"
FT                   /translation="MSRTFEELVAEAEAVSVAGWDFSWLDGRATEQRPSWGYQRLMGER
FT                   MASASAALDIQTGGGEVLAGVETLPPLTVATESWPPNIDKATRLLHPRGVAVVVDEDEP
FT                   PLPFGAEAFDLVVSRHPVSTWWEEIARVLRPGGTYLSQQVGPASVFEVVEFFLGPQPPE
FT                   VRRGRQPEDAQALAEAAGLEVVELRSESLRTEFFDVGAVIYFLRKVIWMVPGFTVEQYR
FT                   DRLRDMHELIQAEGPFLAHTTRFLIEARKPG"
     atgtcgcgaa ctttcgagga actggtggcc gaggctgagg ccgtgtcggt ggcgggctgg        60
     gacttctcct ggttggacgg tcgggcgacc gaacagcggc cctcgtgggg atatcagcgg       120
     ttgatgggcg agcggatggc ctcggcgtcg gcggccctgg acattcagac cggtggcggc       180
     gaggtgctgg cgggcgtgga gacgttgccg ccgttgacgg tggcgaccga gtcgtggccg       240
     ccgaacatcg acaaggcgac ccggctgctg catccgcgtg gggtggcggt cgtggtggac       300
     gaggacgagc cgccgctgcc gttcggggcc gaggccttcg atctggtggt gagccggcat       360
     ccggtgtcga cgtggtggga ggagatcgcg cgggtgctgc ggccgggcgg gacgtacctg       420
     tcgcagcagg tcggtccggc gagtgtcttc gaggtggtcg agttcttcct ggggccgcag       480
     ccgcccgagg tgcggcgggg tcgacagccc gaggacgccc aggcgctcgc cgaggccgcg       540
     ggcctggagg tggtggagct gcggtcggag tcgctgcgga ccgagttctt cgacgtcggg       600
     gcggtgatct acttcctgcg caaggtgatc tggatggttc ccgggttcac tgtggagcag       660
     tatcgggacc ggctgcgcga catgcacgag ctgatccagg cggaggggcc gttcctggcc       720
     cacaccaccc ggttcctgat cgaggcgcgc aagcccggct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page