(data stored in SCRATCH zone)

EMBL: CP001778.PE553

CP001778.PE553       Location/Qualifiers
FT   CDS_pept        595369..596025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0562"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cak:Caul_0015 peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40276"
FT                   /db_xref="GOA:D3Q5X7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X7"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADD40276.1"
FT                   /translation="MLILVVDTSTPAVTAAIAEFDGTTMSMPEGSVVVNPRAHGEQLAP
FT                   LIQGELAARGAVPGDVGAVVAGLGPGPFTGLRAGLVTAAAMAHALDVPVYGVCSLDGIG
FT                   AMTSGRVFVATDARRKEVYWAVYEDGVRVEGPEVAAPETLVERAKAADGAYGDGVHRYA
FT                   DVLGVAPAGAPRYPHPGRLAWVARERIVAKEPSESLTPLYLRRPNVNIGGVQQRA"
     gtgctgattc ttgtcgtgga cacctccact ccggccgtga cggccgcgat cgccgagttc        60
     gacggcacca ccatgtcgat gcccgagggc agcgttgtgg tgaaccctcg ggctcatggg       120
     gagcagctgg cgccgctgat acagggcgag ctggccgcgc gcggggctgt gcccggtgat       180
     gtgggggccg tggtggcggg gctggggccg gggccgttca ccggtttgcg ggccgggctg       240
     gttaccgccg ctgcgatggc gcacgcgctc gatgttcccg tgtacggggt ttgctcgttg       300
     gacgggatcg gggctatgac gagtgggcgg gtgttcgtcg ctaccgatgc tcgtcgtaaa       360
     gaggtgtact gggccgttta tgaggacggt gtgcgcgttg aggggcccga ggtggcggcc       420
     ccggagacgt tggtggagcg ggccaaggcc gcggatgggg cttatgggga tggggtgcat       480
     cgttatgccg acgtgctggg cgtcgctccg gccggggcgc cgcgttatcc gcatcccggg       540
     cggttggcct gggtggctcg ggagcggatc gtcgccaagg agccgtccga gagcttgacg       600
     ccgctgtatt tgcgacgtcc caacgtgaac atcggcggag tccagcagcg tgcctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page