(data stored in SCRATCH zone)

EMBL: CP001778.PE567

CP001778.PE567       Location/Qualifiers
FT   CDS_pept        606804..607310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0576"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   scl:sce6833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40290"
FT                   /db_xref="GOA:D3Q5Z1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z1"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADD40290.1"
FT                   /translation="MTTTATTETGEITSRLPDLTKEFPELAALSGALHKAIRDSPVPQT
FT                   TIRLALLRAAQIVGSTYHTIRMTAEMRKADETEERITAVATWQGAPYFTDAERVALELA
FT                   EAVLTPNPFGERVSDELFARASVHYDDRAMWALTIALGQLCLFIPVAVIAKPIPGRPFG
FT                   KNYSR"
     atgaccacca ccgcgacaac cgagaccggc gagatcacct cgcgcctgcc cgacctcacg        60
     aaagagttcc ccgaactggc ggcgctgtcg ggcgcgctgc acaaggccat ccgcgacagc       120
     ccggttccgc agaccaccat caggctggcg ctgctgcggg ccgcgcagat cgtcggcagc       180
     acttaccaca ccattcgcat gaccgccgag atgcgcaagg ccgacgagac cgaggagcgg       240
     atcaccgccg tggcgacctg gcagggagcc ccctacttca ccgacgccga acgcgtcgcg       300
     ctggagctgg ccgaggccgt cctcaccccg aacccgttcg gcgagcgcgt ttccgacgag       360
     ctgttcgcca gggcctcggt ccactacgac gacagggcga tgtgggcgct gacgatcgcg       420
     ctgggtcagc tgtgcctgtt catcccggtg gccgtcatcg ccaaaccgat cccgggccgc       480
     cccttcggca agaactacag tcgctag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page