(data stored in SCRATCH zone)

EMBL: CP001778.PE585

CP001778.PE585       Location/Qualifiers
FT   CDS_pept        623873..624763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0594"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mno:Mnod_8081
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40308"
FT                   /db_xref="GOA:D3Q609"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q609"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADD40308.1"
FT                   /translation="MKKRSLIATAGVLAAGGAAALAYASLIERFRFQLRRFDVPVLAPD
FT                   TEPLRILHISDLHLSPNSHKEVEWVASLAALDPDLVVLTGDNLAHPEAVSTVSAALEPL
FT                   FTYPGVFVFGSNDYYAPVLKNPFTYFNPNREHKYGEELPTEELRKMLTGAGWRDLNNAT
FT                   TTIPIADRTIAVAGVDDPHFDLDDYDLIAGEAPTDASVTLGLTHSPEPRVLDQMAADGY
FT                   QLLLAGHTHGGQVCVPGYGALVTNCGIDRKRVKGLHRYGSSWLHVSAGLGTSPYAPIRF
FT                   ACHPEASILTLIPRT"
     atgaagaagc gaagccttat cgccaccgcc ggggtgctcg ccgccggtgg cgcggcggcc        60
     cttgcctacg cgagcctcat cgagcgattc cgcttccaac tgcggcgctt cgacgtaccc       120
     gtcctggcac ccgacaccga acccctgcgc atactccaca tctccgacct ccacctcagc       180
     cccaacagcc acaaggaagt cgaatgggtc gcctccctgg cagccctcga ccccgacctg       240
     gtcgtcctca cgggagacaa cctcgcccac cctgaagcgg tctccacggt ctctgcggcc       300
     ctggaacccc tcttcaccta cccgggcgtc ttcgtcttcg gctccaacga ctactacgcc       360
     ccggtcctca aaaacccgtt cacctacttc aaccccaacc gcgaacacaa atacggcgaa       420
     gaactcccca ccgaagaact ccgcaaaatg ctcaccggcg cgggctggcg cgacctcaac       480
     aacgccacca ccaccatccc catagccgac cgcaccatcg cggtagcggg cgtggacgac       540
     ccccacttcg acctggacga ctacgacctc atagcgggcg aagcccccac cgacgcctcg       600
     gtaaccctgg gcctcaccca ctcacccgaa ccccgcgtcc tggaccaaat ggcagccgac       660
     ggctaccaac tcctcctagc gggccacacc cacggcggcc aagtctgcgt ccccggctac       720
     ggcgccctgg tcaccaactg cggcatagac cgcaaacgcg tcaaaggcct ccaccgctat       780
     ggcagctcct ggctccacgt ctcggccggt ctgggcacca gcccctacgc cccaatccgt       840
     ttcgcctgcc acccagaagc cagcatcctg accctcatcc cccgcaccta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page