(data stored in SCRATCH zone)

EMBL: CP001778.PE587

CP001778.PE587       Location/Qualifiers
FT   CDS_pept        complement(626163..627032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40310"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q611"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40310.1"
FT                   /translation="MTTPSEIRQIAQQIYELAQEKRMIEWVRDHPDSTDTKEDLGLAEK
FT                   YAYIEGEFERFTEPNLTPFDDISKQLEDAYDKIAGKDASYLSSDSSLKIAEWRGTAKTS
FT                   FDDNYITPWETYREFHKELIRALKSAADSHRDLYSRMRGRAYSIGEATVEGLKGIDGWP
FT                   PFLSEKEGKDILFKVAGLLSIAASASPMGAVAKAVAVIQIADASRTVTEAAGSIEAKFV
FT                   NEILDQMKKKLDELEDDSQAEEKTISKGLKKNIDAIEKKLDDIVPPSPELADVNPDDPG
FT                   GKLKPPAS"
     atgactaccc cgagcgagat ccgacagatc gcccaacaaa tttacgagct ggcacaggaa        60
     aagcgaatga tcgaatgggt tcgcgaccat cctgattcga ccgacacaaa agaggacttg       120
     gggctcgccg aaaaatacgc gtacatcgaa ggagaatttg agcgcttcac ggaaccgaac       180
     cttactccgt tcgatgacat ttccaaacag cttgaagacg cctacgacaa gatcgctgga       240
     aaagatgcct cctatttgtc gagtgatagc tcgctaaaga tagcggagtg gcgtggaaca       300
     gcaaaaactt ccttcgatga caactacatc actccatggg aaacttaccg agagttccat       360
     aaggaactaa ttcgtgccct aaaatccgca gcagattccc accgcgatct ctatagccgc       420
     atgcgcggcc gcgcctattc cataggcgaa gcaacagtcg aaggattgaa aggaatcgac       480
     ggatggcctc ccttcctctc agaaaaggaa ggcaaggata tccttttcaa ggtcgctgga       540
     ctgctttcga tcgccgcgtc ggcgagccct atgggcgccg tcgccaaagc tgttgcagtc       600
     attcagatag ccgatgcctc taggacagtc acagaagccg caggaagcat cgaagccaag       660
     tttgtcaacg agatcctgga ccaaatgaag aaaaagctag atgaactcga agacgattca       720
     caagcagaag aaaagacgat ttcaaagggg ctcaagaaga atatagacgc aatagagaaa       780
     aagctagatg acattgtccc accctccccg gaactagccg atgtcaatcc agatgatcca       840
     ggaggtaaac taaagccacc tgcaagctaa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page