(data stored in SCRATCH zone)

EMBL: CP001778.PE592

CP001778.PE592       Location/Qualifiers
FT   CDS_pept        634081..636867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0601"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; SMART: Tetratricopeptide domain
FT                   protein; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40315"
FT                   /db_xref="GOA:D3Q6R6"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD40315.1"
FT                   /translation="MLVRLLGSVEIASATGWARAGPAKRSCVLAALAVTPRVPVTLATL
FT                   TERVWGTGAPSSAHSTLYGHIAHLRTLLRDCPGEVTLRRSGIDGYVLDVEPELIDVHAL
FT                   RSLVHAARDQLLVGDGERAVERWRRAGELVRGEALAGVKGDWAAEVRSGLRREHAALLA
FT                   ERFTVELELNRHNEIIDELADQVARHPLSESLVECLMTALYRSGRPAEALSCFAEARFR
FT                   LAERLGADPGTRLRELNRRILKQDPELARPTPASAPVARGGHPFAQLPAAPRLFTGRAA
FT                   ELSELDNALDAPDGARLWTVSGPGGIGKSWLALHWSHRRRDAFADGQLYVNLHGFDPGT
FT                   APTPPETALRGLLETLGVAPAAIPTSLDAMSGLYRSLLVGKRVLILVDDARDSRQVIPL
FT                   LPGDDAAFTVVTGRPGLATLATSHGAAGLRLDTLSHNESREAFSRHLGHDRIAAEPEAT
FT                   AELVGSCAGLPLALGILAARAAAHPGLPLAALAESVRDDSARLDALDTGELSASLRAVL
FT                   EGSLAAVRPEAARLFALLGLAPGIDAERHAVASLAAASLGHSDALLRELDSANLVEQRV
FT                   PGRYRMHDLTRLYAAERAEVDLDESDRDAALRRVVDHYLYTAAAGRELMQRGLIPRDLG
FT                   QPAPGCVTRPLTDLEAAKRWFAAEHVNIVAAQRKAAELGWDASVWRLAWALTTFQILRR
FT                   RSDEGVPVWRRAVAAAENLDDLFGQVVAHHTLSQMLIYAGDYDDAATHAARALDRAEAS
FT                   GDVHQLVGAHDAMSKAYVRQGDYRLALRHSTRSLDLARRTGNQILEAQAHNSVGWHLAH
FT                   LGEYAAARGHCEQALDKARAIPDDYLAALILDSLGFVASRDDRPADASVHYRQALELVR
FT                   RFGATEQEPTTMVALAEAEEALGRRDEAERLRREAADLYEAQGYAEEAALLRKPASG"
     gtgctggtac ggctgctggg atccgtcgag atcgccagtg ccaccggctg ggcgcgcgcc        60
     gggcccgcca aacgcagctg tgtgctcgcc gcgctggcgg tcacgccgcg cgtcccggtc       120
     acgctggcga cgctcaccga gcgggtgtgg ggcaccggtg cgccctcgtc ggcccacagc       180
     accctgtacg ggcacatcgc ccacctgcgc acgctcctgc gcgactgccc cggcgaggtg       240
     acgctgcgcc gttccgggat cgacggctac gtcctggacg tcgaacccga actcatcgac       300
     gtgcacgcgc tgcggtcgct ggtgcacgcg gcccgcgatc agctgctggt cggggacggc       360
     gagcgggcgg tcgagcggtg gcgacgcgcc ggggaactgg tgcgcggcga ggcgctggcc       420
     ggggtcaagg gggactgggc cgccgaggtc cgttcgggtc tgcgtcgcga gcacgcggcc       480
     ctgctggccg agcggttcac cgtcgagctg gaactgaacc ggcacaacga gatcatcgac       540
     gagctggccg atcaggtcgc gcggcatccg ctgtcggaga gcctggtcga gtgcctcatg       600
     accgcgctgt atcgcagcgg tcgtccggcc gaggcgctgt cgtgtttcgc cgaggcccgg       660
     ttccggctgg ccgagcggct cggcgccgac cccggtacgc ggttgcggga actgaaccgg       720
     cgcatcctca agcaggatcc ggaactggcg cggccgactc ccgcgtccgc accggtcgcg       780
     cgcggcgggc acccgttcgc gcaactgccc gcggcgccac ggttgttcac cggacgcgcc       840
     gccgaactgt ccgaactgga taacgcgctc gacgcccccg acggtgcgcg actgtggacc       900
     gtcagcggtc ccggcggcat cggcaagagc tggctggcac tgcactggtc gcatcgccgt       960
     cgcgacgcct tcgccgacgg ccagctgtac gtcaacctgc acggcttcga tcccggcacc      1020
     gctccgacgc cgccggagac ggcgctgcgg ggcctgctgg agaccctggg ggtggccccc      1080
     gcggcgatcc cgaccagcct ggacgccatg tccgggctgt accgcagcct gctcgtcggc      1140
     aagcgggtgc tgatcctcgt cgacgacgcc cgcgactccc ggcaggtgat cccgctgctg      1200
     cccggcgacg acgcggcgtt caccgtcgtc accggacgcc ccgggctcgc gacgctggcc      1260
     acctcccacg gcgccgccgg actgcggctg gacacgttga gccacaacga atcgcgcgag      1320
     gcgttctcgc ggcacctggg gcacgaccgg atcgcggcgg aaccggaggc gacggccgag      1380
     ctggtcggca gctgcgccgg actgccgctg gcgctgggca tcctggccgc gcgcgccgcc      1440
     gcccaccccg gcctcccgct cgccgcactg gcggagtcgg tgcgcgacga ctccgcgcgg      1500
     ctggacgcgc tggacaccgg cgagctgtcg gccagcctgc gggcggtgct ggagggatcg      1560
     ctggcggcgg tgcgacccga ggccgcccgg ctgttcgcgc tgctgggcct ggctcccggc      1620
     atcgacgccg aacgccacgc cgtcgccagt ctcgcggcgg cgtcgctcgg ccacagcgac      1680
     gcgctgctgc gggaactcga ttccgccaac ctcgtcgagc agcgggttcc gggccggtac      1740
     cggatgcacg acctcacccg cttgtacgcc gccgaacgcg ccgaggtcga cctcgacgag      1800
     agcgaccgcg acgccgcgct gcgccgcgtc gtcgaccact acctctacac cgccgcggcg      1860
     ggccgggaac tcatgcagcg gggactgatt ccccgcgacc tcgggcagcc ggcacccggt      1920
     tgtgtgaccc gtccgctgac cgatctggaa gccgcgaaac gttggttcgc cgcggaacac      1980
     gtcaacatcg tcgcggcgca gcgcaaggcc gccgagctcg gctgggacgc gtcggtgtgg      2040
     cggctggcgt gggcactgac cacgttccag atcctgcgcc gacgcagcga cgagggagtg      2100
     ccggtgtggc gccgggccgt cgcggcggcg gaaaacctgg acgacctgtt cggacaggtg      2160
     gtcgcacacc acaccctcag ccagatgttg atctacgcgg gcgactacga cgacgccgcg      2220
     acgcacgcgg cccgcgcgct cgaccgggcc gaagcctccg gcgacgtcca ccagctcgtc      2280
     ggcgcccacg acgcgatgag caaggcatac gtccgccagg gcgactatcg gctggcgctg      2340
     cggcattcca cgcgatccct cgacctggcg cggcgaaccg gcaaccagat cctcgaagcc      2400
     caggcccaca actcggtcgg ctggcacctg gcccacctgg gcgagtacgc ggccgcgcga      2460
     ggccactgcg agcaggccct ggacaaagcc cgcgccatcc ccgacgacta cctcgccgcg      2520
     ctcatcctcg acagcctcgg gttcgtcgcc tcgcgcgacg accggcccgc cgacgcgtcc      2580
     gtccactatc ggcaggcact ggagctggtg cgccgtttcg gtgcgacaga acaggaaccg      2640
     acgaccatgg tcgcgctggc cgaagccgag gaggcgctgg gtcggcgcga cgaggccgag      2700
     cggttgcgcc gcgaagccgc cgacctgtac gaagcccagg gctatgccga ggaggccgcc      2760
     ctgctgcgca aacccgcgtc cggctga                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page