(data stored in SCRATCH zone)

EMBL: CP001778.PE597

CP001778.PE597       Location/Qualifiers
FT   CDS_pept        641020..642045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40320"
FT                   /db_xref="GOA:D3Q6S1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6S1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40320.1"
FT                   /translation="MNSLPYEGVRVLVLGSGPRVGKARQLLSEGGATIVSNFSSQVTYV
FT                   VVDRTVPHSAPQVVAARRAAIPVVTTSELQTWPGMEGLAAVRYLTPARLPVSGPVMTAT
FT                   PVPVYTAPLPRPRGSSGPDTTLMALSWAAFPLLTGGLAMPFITAHVARKLRSRTHAMLA
FT                   AGYGGALVVSMLGFIAGVGLDVDIFILVSMFTWLCCWLGGSVHAFLMYESVSRDGGSDG
FT                   EPRVSDPRNAQALAAIEHRRNLRDEARQLAKRDPVAARELGIGRPDRHSSYDDGGLIDV
FT                   NNAPASILKTLPGVTDEVAQEIIRFRELTGPFESTSDVVVHTSFEPRYVDRFDELALYV
FT                   A"
     atgaattcct tgccctacga aggcgttcgt gtgctcgtgc tcggcagcgg accccgcgtc        60
     ggcaaggccc ggcaactgct gtccgagggc ggggcgacca tcgtctccaa cttcagttca       120
     caggtcacct atgtggtggt cgaccggacg gttccgcaca gcgcccccca ggtggtggcc       180
     gcccgccgcg ccgcgatccc ggtcgtgacc acctcggagc tgcagacctg gcccggcatg       240
     gagggcctgg cggccgtccg ttacctgacg cccgcacggc tgccggtgtc cggaccggtc       300
     atgaccgcca cccccgtacc ggtgtacacc gcgccactgc cgaggccgcg cggttcctcc       360
     ggtccggaca cgaccctgat ggccctgagc tgggcggcgt tcccgctgct caccggtggc       420
     ctcgcgatgc cgttcatcac cgcccacgtg gcccgcaaac tccgctcccg cacccacgcg       480
     atgctcgcgg ccggatacgg cggggcgctg gtggtgtcca tgctgggctt catcgccggt       540
     gtcgggctgg acgtcgacat cttcatcctg gtgagcatgt tcacctggtt gtgctgctgg       600
     ctgggcggca gcgtccacgc gttcctcatg tacgagtcgg tctcgcgtga cggcggcagc       660
     gacggcgaac cccgggtgtc cgacccgcgc aacgcccagg ccctcgcggc catcgaacac       720
     cgccgcaacc tgcgcgacga ggcacgccaa ctcgccaaac gcgacccggt ggccgcccgc       780
     gaactgggca tcggacggcc cgaccggcac tccagttacg acgacggcgg cctgatcgac       840
     gtcaacaacg cccccgcctc gatcctcaag accctgccgg gcgtcaccga cgaggtcgcc       900
     caggagatca tccggttccg cgaactgacc ggcccgttcg agtccacctc ggacgtcgtc       960
     gtgcacacca gtttcgaacc ccgctacgtc gaccgtttcg acgagctcgc cctgtacgtg      1020
     gcctag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page