(data stored in SCRATCH zone)

EMBL: CP001778.PE60

CP001778.PE60        Location/Qualifiers
FT   CDS_pept        complement(66058..66840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0061"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: met:M446_1738
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39783"
FT                   /db_xref="GOA:D3Q0B9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD39783.1"
FT                   /translation="MSDVVILTGLADSRWTWRPVETALADAGTVLIADRTRHQTFPTLA
FT                   DEIVRVRDLVVGHRLGPPVVVAHSFGALIAEAYARRYPVAGLVLVDPSWDPDATGRGAI
FT                   EAGLVRAAFHGAGALGKALDVTGLARHLGPALWSLSLRAVALRRPGAGVVAATRSVYRR
FT                   GETLVAAAAEELAFRDFAAALAKSRATSHAPEVPVVVLTAVGTDPKSRDSRHWIAAHRR
FT                   LAALFPNGRHEVVRGAKHMMHIDRPEVIVREVNRLLAG"
     atgagcgatg tcgtgatcct caccgggctg gccgacagcc gttggacctg gcggccggtc        60
     gagaccgcgt tggcggacgc ggggaccgtg ctcatcgccg atcggactcg gcaccagacg       120
     tttcccacgc tcgccgacga gatcgtgcgg gtgcgggatc ttgttgtggg gcatcggttg       180
     gggccgcccg tggtggtcgc tcattcgttt ggggcgctca tcgccgaggc ttacgcgcgg       240
     cggtatccgg tggcggggct ggtgttggtg gatccgtcct gggaccccga cgccacgggg       300
     cgcggggcga tcgaggcggg gctggtccgg gcggcgttcc acggggccgg ggccctcggg       360
     aaggcgctcg acgtcaccgg gctcgcccgc cacctcgggc ccgcgctgtg gagcctttcg       420
     ctgcgggcgg tggcgttgcg gcggcccggc gccggggtgg tcgcggctac ccggtcggtg       480
     taccggcgcg gcgagacgct ggtggccgcc gccgctgagg agttggcgtt ccgggatttc       540
     gcggcggccc tggcgaagtc gcgcgctacc agccacgcgc ccgaggtgcc cgtcgtcgtg       600
     ctgaccgccg tgggcaccga cccgaagagc cgggacagca ggcactggat cgccgcgcac       660
     cggcggctgg cggccctgtt tccgaacggg cgccacgaag tcgtgcgggg tgccaagcac       720
     atgatgcata tagaccgtcc cgaagtgatt gtgcgggaag tcaatcgtct gctggcggga       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page